Nicotiana tomentosiformis: 104106138 Help Entry 104106138         CDS       T05025                                  Name (RefSeq) uncharacterized protein   KO K03873   elongin-B Organism nto  Nicotiana tomentosiformis Pathway nto04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:nto00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     104106138  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nto04121]     104106138    03400 DNA repair and recombination proteins [BR:nto03400]     104106138 Ubiquitin system [BR:nto04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      104106138    Cul5 complex      104106138 DNA repair and recombination proteins [BR:nto03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      104106138 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Dsc3_N UBL_UBAC1 Ubiquitin_2 DUF7909 DUF4861 Motif Other DBs NCBI-GeneID:  104106138 NCBI-ProteinID:  XP_009612919 LinkDB All DBs Position 5:complement(28551634..28563730) Genome browser AA seq 104 aa AA seqDB search MAMYIRVKRNRTTYFIQCDPTETILQIKEKLYNLIDQPVNDQRLILMPAGDVLEDSKSLA DQKVENDAVVALTLRKDDNAFEDVNIVRPNDFYQSHDSEGGANW NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcaatgtatatccgtgtcaagcgtaataggaccacctactttattcaatgtgaccca accgagacaattctacaaataaaggagaaattgtataacctcatagatcaaccagttaat gatcagcgattaatcttgatgcctgctggagacgtgttggaagactcgaagtccctagct gatcagaaggttgaaaatgatgctgtggtggcactgactctgagaaaagatgacaatgca tttgaggatgtaaatattgtgagaccgaatgacttttaccagtcccacgattcagaaggt ggtgctaattggtga

DBGET integrated database retrieval system