Nicotiana tomentosiformis: 104118453 Help Entry 104118453         CDS       T05025                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism nto  Nicotiana tomentosiformis Pathway nto03083   Polycomb repressive complex nto04120   Ubiquitin mediated proteolysis nto04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nto00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104118453    04120 Ubiquitin mediated proteolysis     104118453   09126 Chromosome    03083 Polycomb repressive complex     104118453  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nto04131]     104118453    04121 Ubiquitin system [BR:nto04121]     104118453    03036 Chromosome and associated proteins [BR:nto03036]     104118453 Membrane trafficking [BR:nto04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     104118453 Ubiquitin system [BR:nto04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      104118453    Cul7 complex      104118453 Chromosome and associated proteins [BR:nto03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      104118453   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      104118453 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ DUF7667 BTB DUF6694 Motif Other DBs NCBI-GeneID:  104118453 NCBI-ProteinID:  XP_070051717 LinkDB All DBs Position 2:77859791..77863729 Genome browser AA seq 151 aa AA seqDB search MSSKKLLVLKTIDGEEFELDEAVAVRSEAIKNMVEDDCASNTIPLPNVDSKTMAKVIEYW QKHSEEGVSEDELKDFDKNFVKVLNYSELYDLILAANYLNDKELLDILCQETADRIKGKT PEEIRKAFNIKNDFTPEEEEQIRKENAWAFD NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtcttccaaaaagctcttggtcctaaagacaatcgacggcgaggaattcgaactcgac gaggcagtggcggtgaggtcagaagccatcaaaaatatggtggaagatgactgcgcttca aacaccattcctttgcctaatgtcgatagcaaaacaatggccaaagtgatcgaatactgg caaaaacactccgaggaaggcgtctcagaggacgagttgaaggattttgacaagaatttt gtgaaggtgctgaattactcggagttgtatgatctaattttagcagctaattatcttaat gataaggagctattggatatattgtgtcaagaaactgctgataggatcaaagggaaaacg ccagaggaaatacgtaaagcatttaacatcaagaatgattttacacctgaggaagaagag caaatccgtaaagaaaatgcttgggcctttgattga

DBGET integrated database retrieval system