Nicotiana tomentosiformis: 104121446 Help Entry 104121446         CDS       T05025                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism nto  Nicotiana tomentosiformis Pathway nto04145   Phagosome nto04148   Efferocytosis nto04517   IgSF CAM signaling nto04518   Integrin signaling nto04620   Toll-like receptor signaling pathway nto05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nto00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     104121446    04518 Integrin signaling     104121446  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     104121446    04148 Efferocytosis     104121446  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104121446  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     104121446  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nto04131]     104121446   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nto04147]     104121446    04031 GTP-binding proteins [BR:nto04031]     104121446 Membrane trafficking [BR:nto04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     104121446  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     104121446   Macropinocytosis    Ras GTPases     104121446  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     104121446 Exosome [BR:nto04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104121446   Exosomal proteins of other body fluids (saliva and urine)    104121446   Exosomal proteins of colorectal cancer cells    104121446   Exosomal proteins of bladder cancer cells    104121446 GTP-binding proteins [BR:nto04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     104121446 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  104121446 NCBI-ProteinID:  XP_009631777 LinkDB All DBs Position 1:81552456..81556958 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLREDKQFFLDHPGAVPLTTAQGEELRKSIGASAYIECSAKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKGQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtctaggttcataaagtgtgtcaccgttggcgacggagctgtgggtaaaact tgtcttctcatttcctataccagcaacacatttcccactgattacgtcccaactgtattc gacaattttagtgcaaatgtggttgtcgatgggagcactgtcaatctggggctgtgggat actgcaggtcaggaggattacaatagattaagaccgttgagctaccggggggcagatgta tttatactggcattttctctcattagcaaagcgagctatgaaaatgtctccaaaaagtgg attcctgaattgaggcattatgctcctggagttccaattattcttgttggaacaaagcta gatctccgagaggataagcaattcttcctggaccatccaggtgctgttccacttaccaca gctcagggtgaagagctgagaaagtcgattggtgcttccgcttacattgaatgtagtgca aaaacacaacagaatgtgaaggctgtttttgatgctgccattaaggtggttctacaacca cccaaacaaaagaagaaaaagaagagaaagggtcaaaaagcctgctctatcttgtga

DBGET integrated database retrieval system