Nicotiana tomentosiformis: 104121446 Help Entry 104121446         CDS       T05025                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism nto  Nicotiana tomentosiformis Pathway nto04145   Phagosome nto04148   Efferocytosis nto04620   Toll-like receptor signaling pathway nto05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nto00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     104121446    04148 Efferocytosis     104121446  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104121446  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     104121446  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nto04131]     104121446   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nto04147]     104121446    04031 GTP-binding proteins [BR:nto04031]     104121446 Membrane trafficking [BR:nto04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     104121446  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     104121446   Macropinocytosis    Ras GTPases     104121446  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     104121446 Exosome [BR:nto04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104121446   Exosomal proteins of other body fluids (saliva and urine)    104121446   Exosomal proteins of colorectal cancer cells    104121446   Exosomal proteins of bladder cancer cells    104121446 GTP-binding proteins [BR:nto04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     104121446 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  104121446 NCBI-ProteinID:  XP_009631777 LinkDB All DBs Position 1:81552456..81556958 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLREDKQFFLDHPGAVPLTTAQGEELRKSIGASAYIECSAKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKGQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtctaggttcataaagtgtgtcaccgttggcgacggagctgtgggtaaaact tgtcttctcatttcctataccagcaacacatttcccactgattacgtcccaactgtattc gacaattttagtgcaaatgtggttgtcgatgggagcactgtcaatctggggctgtgggat actgcaggtcaggaggattacaatagattaagaccgttgagctaccggggggcagatgta tttatactggcattttctctcattagcaaagcgagctatgaaaatgtctccaaaaagtgg attcctgaattgaggcattatgctcctggagttccaattattcttgttggaacaaagcta gatctccgagaggataagcaattcttcctggaccatccaggtgctgttccacttaccaca gctcagggtgaagagctgagaaagtcgattggtgcttccgcttacattgaatgtagtgca aaaacacaacagaatgtgaaggctgtttttgatgctgccattaaggtggttctacaacca cccaaacaaaagaagaaaaagaagagaaagggtcaaaaagcctgctctatcttgtga

DBGET integrated database retrieval system