Nicotiana tomentosiformis: 3776341 Help Entry 3776341           CDS       T05025                                  Symbol atpH, NitoCp011 Name (RefSeq) ATP synthase CF0 C subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism nto  Nicotiana tomentosiformis Pathway nto00190   Oxidative phosphorylation nto00195   Photosynthesis nto01100   Metabolic pathways Module nto_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:nto00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     3776341 (atpH)    00195 Photosynthesis     3776341 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:nto00194]     3776341 (atpH) Photosynthesis proteins [BR:nto00194]  Photosystem and electron transport system   F-type ATPase [OT]    3776341 (atpH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  3776341 NCBI-ProteinID:  YP_398846 UniProt:  Q33C51 LinkDB All DBs Position Pltd:complement(13802..14047) Genome browser AA seq 81 aa AA seqDB search MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccactgatttctgccgcttccgttattgctgctggattggccgtagggcttgct tctattggacctggggttggtcaagggactgctgcgggtcaagctgtagagggtatcgcg agacagcctgaggcagagggaaaaatacgaggtacgctattgcttagtctagcttttatg gaagctttaacaatttatggactggttgtagcattagcacttttatttgcgaatcctttt gtttaa

DBGET integrated database retrieval system