Nocardia terpenica: CRH09_00140 Help Entry CRH09_00140       CDS       T05168                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism ntp  Nocardia terpenica Pathway ntp00362   Benzoate degradation ntp00621   Dioxin degradation ntp00622   Xylene degradation ntp01100   Metabolic pathways ntp01120   Microbial metabolism in diverse environments ntp01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:ntp00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CRH09_00140    00622 Xylene degradation     CRH09_00140    00621 Dioxin degradation     CRH09_00140 Enzymes [BR:ntp01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      CRH09_00140 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 Motif Other DBs NCBI-ProteinID:  ATL71368 UniProt:  A0A164IB94 LinkDB All DBs Position complement(27708..27893) Genome browser AA seq 61 aa AA seqDB search MPIVTVQQGPRTVELKRELVRRITDAFVDAYQIPAETVQVWIQEFTPDSWGAAGRLTADG K NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgcccatcgtcaccgtgcagcagggtccgcgcaccgtcgagctcaagcgcgagctggtg cgccgcatcaccgacgcattcgtggacgcctaccagattcccgccgagacggtgcaggtc tggattcaggagttcaccccggacagctggggcgcggccggtcgcctgaccgcggacggc aagtag

DBGET integrated database retrieval system