Nocardia terpenica: CRH09_35630 Help Entry CRH09_35630       CDS       T05168                                  Name (GenBank) chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism ntp  Nocardia terpenica Pathway ntp00400   Phenylalanine, tyrosine and tryptophan biosynthesis ntp01100   Metabolic pathways ntp01110   Biosynthesis of secondary metabolites ntp01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:ntp00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     CRH09_35630 Enzymes [BR:ntp01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      CRH09_35630 SSDB OrthologParalogGFIT Motif Pfam:  CM_2 DUF632 Motif Other DBs NCBI-ProteinID:  ATL70723 UniProt:  A0A164JPT9 LinkDB All DBs Position 7989024..7989317 Genome browser AA seq 97 aa AA seqDB search MSTSTTATGSDSALPSSEAEIDKLRKEIDRLDAEILAAIKRRTEISRMIGRTRMANGGTR LVHSREMKVLERFSELGQEGHTLAMLLLRLGRGRLGH NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagcacctctacgaccgcgaccggatccgattcagcgctgcccagcagcgaggccgag atcgataagctccgcaaggagatcgaccggctcgacgccgagatcctcgccgcgatcaag cgccgcaccgagatctcgcggatgatcggccgcacgcggatggccaacggcggcacccgc ctggtccactcccgtgagatgaaggtgctcgagcgcttcagcgagctcggccaggagggc cacaccctcgccatgctgctgctccgtctcggccgcggccgcctcggccactga

DBGET integrated database retrieval system