Novibacillus thermophilus: B0W44_00130 Help Entry B0W44_00130       CDS       T04694                                  Name (GenBank) hypothetical protein   KO K06317   inhibitor of the pro-sigma K processing machinery Organism ntr  Novibacillus thermophilus Brite KEGG Orthology (KO) [BR:ntr00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     B0W44_00130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BofA Motif Other DBs NCBI-ProteinID:  AQS54441 UniProt:  A0A1U9K327 LinkDB All DBs Position 22978..23250 Genome browser AA seq 90 aa AA seqDB search MDWGWTVGAIVGGMVVVFMLTAYAAKPLKWMWLGILYTAVGAVALYLANWIGGQWGFHLP INPVTAFVTGVLGWPGLLCLVVIKVWVVGL NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtggactggggttggacggtcggggctatcgtcggagggatggtggtcgtgttcatgctg acggcttatgcggcgaaaccgctcaagtggatgtggcttggcatactgtatacggctgtc ggtgccgttgccctttatttggccaactggatcggcggacagtgggggtttcacttgccg atcaatccggtgacggcattcgtcaccggggtgttggggtggcctggtctgttgtgtcta gttgtgatcaaagtgtgggttgtcgggctgtaa

DBGET integrated database retrieval system