Novibacillus thermophilus: B0W44_07070 Help Entry B0W44_07070       CDS       T04694                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ntr  Novibacillus thermophilus Pathway ntr01100   Metabolic pathways ntr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ntr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B0W44_07070    00074 Mycolic acid biosynthesis     B0W44_07070   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B0W44_07070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Uricase HLH Motif Other DBs NCBI-ProteinID:  AQS55581 UniProt:  A0A1U9K6C3 LinkDB All DBs Position 1416302..1416535 Genome browser AA seq 77 aa AA seqDB search MADTFERVKKIIVDRLDVEESQVVPTASFKDDLGADSLDVVELVMELEDEFDMEISDEEA EKISTVQEVIDYIESHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggcagacacgtttgaaagagtgaaaaaaattatcgtcgatcgtctcgatgtggaagag tctcaagtcgttccgacagcttcgttcaaagacgacttgggggcggactctctcgacgtc gttgaattggtcatggaattggaagatgagttcgacatggagatttccgacgaggaagcg gaaaaaatttcgaccgtacaagaggtgatcgattacatcgaatcgcaccagtaa

DBGET integrated database retrieval system