Candidatus Nitrosoglobus terrae: TAO_1044 Help Entry TAO_1044          CDS       T05173                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ntt  Candidatus Nitrosoglobus terrae Pathway ntt00998   Biosynthesis of various antibiotics ntt01100   Metabolic pathways ntt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ntt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TAO_1044    00074 Mycolic acid biosynthesis     TAO_1044   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TAO_1044 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 YqbF_HeH Motif Other DBs NCBI-ProteinID:  BAW80414 UniProt:  A0A1Q2SMQ8 LinkDB All DBs Position complement(1113658..1113897) Genome browser AA seq 79 aa AA seqDB search MNDIEARVKEIVIEQLGANPEEVTNESSFVDDLGADSLDTVELVMALEEAFECEIPDEEA EKISTVQEAIDYIKERQNK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaatgatatagaagctcgggttaaggaaattgtcattgagcaacttggagctaaccct gaagaagtaactaatgagtcatcttttgtagatgacttaggcgctgactcgctagatacc gtagagcttgttatggcgttggaagaggcttttgaatgtgagattcctgacgaagaagca gaaaaaatatctactgttcaggaagctatcgattatattaaagaacgtcaaaataaataa

DBGET integrated database retrieval system