Neodiprion virginianus: 124308166 Help Entry 124308166         CDS       T09046                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism nvg  Neodiprion virginianus Pathway nvg04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:nvg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124308166  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nvg04121]     124308166    03400 DNA repair and recombination proteins [BR:nvg03400]     124308166 Ubiquitin system [BR:nvg04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      124308166    Cul5 complex      124308166 DNA repair and recombination proteins [BR:nvg03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      124308166 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  124308166 NCBI-ProteinID:  XP_046626553 LinkDB All DBs Position 1:4693005..4695573 Genome browser AA seq 117 aa AA seqDB search MDVFLMIRRKKTTIFTDAKDNTTVLELKKIIEGILKIAPANQQLYSKDNVIMSDNKFLSD YGMTSAVAKAQCPALVALALRQEGGQFEPLEMTPYSLPPDLPDVMKSQEANGKEQTP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggacgtattcctcatgatcaggcgaaagaaaacgactattttcacagacgctaaagac aacactaccgttcttgaattaaaaaagatcatagaaggtatactgaagattgctccggcg aatcaacaactctacagcaaagacaatgtcatcatgtccgataacaaatttttgtcggat tacggaatgacgtcggcagtggcaaaagcacaatgccctgctctggttgctttagcccta cgccaagaagggggtcagtttgaacctctggaaatgacaccttactcgttaccacctgat ctccctgatgtaatgaaatcccaggaagccaacggcaaagaacaaactccgtga

DBGET integrated database retrieval system