Neodiprion virginianus: 124309529 Help Entry 124309529         CDS       T09046                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism nvg  Neodiprion virginianus Pathway nvg04814   Motor proteins Brite KEGG Orthology (KO) [BR:nvg00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     124309529  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:nvg03037]     124309529    04812 Cytoskeleton proteins [BR:nvg04812]     124309529 Cilium and associated proteins [BR:nvg03037]  Motile cilia and associated proteins   Dynein arm    124309529 Cytoskeleton proteins [BR:nvg04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      124309529 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  124309529 NCBI-ProteinID:  XP_046629163 LinkDB All DBs Position 7:complement(23499453..23501027) Genome browser AA seq 111 aa AA seqDB search MEDMQEETQFVVDDVSKIIKDAIEVSIGGNAYQHTKVNQWTSHVVEACLGNLTKLQKPYK YIVTCTIMQKNGAGLHTASSCFWDNATDGSCTVRWENKTMYCIVSVFGLAI NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggaagatatgcaggaggagacccaatttgtcgtcgacgatgtcagcaagataataaaa gatgcgatcgaggtttccatcgggggcaacgcctaccaacacactaaggttaatcaatgg acatctcacgtagttgaagcctgtctgggaaacctcaccaagctacagaaaccttacaaa tatatcgtgacttgtaccatcatgcaaaagaacggtgcaggcttgcatacggcaagttcg tgcttttgggacaatgcaacggatggaagttgcacagttcgctgggagaacaaaacgatg tattgtatcgtgtccgtttttggtctggcgatttaa

DBGET integrated database retrieval system