Nasonia vitripennis (jewel wasp): 100115470 Help Entry 100115470         CDS       T01081                                  Symbol GstS8 Name (RefSeq) glutathione S-transferase S8   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism nvi  Nasonia vitripennis (jewel wasp) Pathway nvi00480   Glutathione metabolism nvi00980   Metabolism of xenobiotics by cytochrome P450 nvi00982   Drug metabolism - cytochrome P450 nvi00983   Drug metabolism - other enzymes nvi01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:nvi00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     100115470 (GstS8)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     100115470 (GstS8)    00982 Drug metabolism - cytochrome P450     100115470 (GstS8)    00983 Drug metabolism - other enzymes     100115470 (GstS8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:nvi02000]     100115470 (GstS8) Enzymes [BR:nvi01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      100115470 (GstS8) Transporters [BR:nvi02000]  Other transporters   Pores ion channels [TC:1]    100115470 (GstS8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_N_2 GST_N_3 GST_C_2 GST_C_7 GST_N_4 Tom37 GST_C_5 GST_N_5 Motif Other DBs NCBI-GeneID:  100115470 NCBI-ProteinID:  NP_001165924 NASONIABASE:  NV15805 UniProt:  A0A7M7TEH3 LinkDB All DBs Position 3 Genome browser AA seq 202 aa AA seqDB search MPSYKVTYFNIKGLGEPIRFILSQAGVDFVDDRVESADWPKIKPTTPFGQMPVLEVDGKK INQTNAICRYLAKQYGLAGANDWENLEIDATVDTIHDLRAKIGAYYYETNAEAKAEKEKA AKELVPFYVERLDEQVKKNGGYFVGGKLTWADLLFVAVLGYMNGIAKEDIIAKVENLKAL REKVLNLPNIKAWVAKRPETEC NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atgccttcctacaaagtcacctacttcaacatcaagggtctcggcgagcccatcaggttc atcttgagccaggccggcgtcgatttcgtcgacgatcgcgtggagagtgccgactggccg aaaatcaagcccactactcccttcggtcagatgcccgttttggaagtggacggcaagaag ataaaccagaccaatgcaatctgtcgctacttggctaagcagtacggtcttgccggcgcc aacgactgggaaaatcttgagatcgacgccacggtcgataccattcacgatcttcgtgcc aagatcggagcctactactacgagaccaatgccgaggctaaggccgagaaggaaaaggcc gcgaaggaactggttccgttctacgttgagcgtttggatgagcaggtgaagaagaacggt ggctatttcgttggtggcaagctcacctgggccgatcttctatttgttgccgtcctcggc tacatgaacggcatcgccaaggaggacatcattgccaaggtcgagaacctcaaggcactt cgcgagaaggtcctcaacctgccgaacatcaaggcttgggtcgcgaaacgcccggagaca gaatgttaa

DBGET integrated database retrieval system