KEGG   Nasonia vitripennis (jewel wasp): 100116226
Entry
100116226         CDS       T01081                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X3
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    100116226
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nvi00199]
    100116226
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     100116226
Cytochrome P450 [BR:nvi00199]
 Cytochrome P450, animal type
  CYP306 family
   100116226
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100116226
NCBI-ProteinID: XP_001600763
NASONIABASE: NV19009
UniProt: A0A7M7R3K2
LinkDB
Position
3
AA seq 491 aa
MLALYGLLAVTFVLLIVYLGRSKKRLPPGPRGLPIIGNLLSINPKTPHESLAKIAWEHGP
VCGLYMGSVYTVLLSDPKLVRQLFAKDTFSGRAPLYLTHGIMKGYGLIASEGELWRDQRK
FVSACLKNFGMVKFPSPKRDQLEKKILVTVDEAVEKLEARSRGAEGLDSHSILHHCIGNL
MNGIVFGKVYDEDDELWKWFQHIQEEGVKHIGVSGPLNFLPFLRFLPRYGNTIQLIVDGQ
NKTHQHYRKILEDHRKFPTEMNSFLATYDEEMKRRMANGEPLASFTETQCFYLLADLYGA
GVDTTLTTLRWFLLFMAAFPDEQAKIQEEISNVVGEKEPNLEDRPSMPRLEAAIMEVQRL
RSVVPIGIPHGTTEDTHIGDYDVPKGSMIVPFQWAIHLNPLYWSDPRAFKPQRFIAEDGG
LAKPAAFLPFQNGKRMCVGDELARMILILFAARILHRLKLSAPPGQTVDLEGDCGITLVP
KPQTLLFKSRR
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgttggcgctatatggactacttgctgtcaccttcgtactactgatcgtctacttagga
cgaagcaagaaacggctaccacctggtcctcgcggtcttcctataattggcaacctactc
tcgataaaccctaagacaccgcacgagagccttgccaaaattgcttgggagcatgggcct
gtgtgcggcttgtacatgggatcggtctatacggtcctcctttccgatcccaagcttgtt
cgccagctattcgccaaggataccttctctggcagagcgccgctttatctcacccacggc
attatgaaaggatacggtctgattgcatcggagggtgaactctggagggatcaacggaaa
ttcgtatctgcttgtctcaagaactttggtatggtcaagtttcccagtcccaagagggat
cagctggaaaagaagatactcgtgactgttgacgaagcagtcgagaaactcgaagcacgt
tcaaggggagccgaaggattagactcccacagtattttgcaccattgcataggaaacctc
atgaatggtattgtatttggcaaagtttacgatgaagacgacgagctttggaagtggttc
caacatattcaagaagaaggggttaaacacataggcgtctcgggaccattaaactttttg
ccatttctcagattcttgccccgttatgggaatacaatacagctcattgtggacggacaa
aataagacgcaccaacactaccggaagatactggaagaccacagaaaatttccaactgaa
atgaacagctttttagcgacatatgacgaggaaatgaaacgacgcatggcaaatggagag
cctcttgcttcttttaccgagacccaatgcttttaccttttggccgatctttacggcgct
ggagttgataccactttgacgacacttcgctggttcctgcttttcatggctgctttccct
gacgagcaggccaaaatccaagaagagatttctaatgtagttggagaaaaggagccgaat
ttggaagatagaccatccatgcctcgactggaagcagctatcatggaagttcagcgcctt
aggagtgtcgtacctattgggattccccatggcacaactgaggatacacacatcggagat
tatgacgttcccaagggcagcatgattgtacctttccagtgggcaatccatttgaaccct
ctgtactggtcggatccacgtgccttcaaacctcaaagattcatagcggaagacggtggt
cttgccaagccagctgcctttctacccttccagaatggtaagaggatgtgtgtgggcgat
gaactcgctcgaatgatactgattctttttgctgcacgcattctgcatcgattgaagcta
tcagcgccacccggtcagaccgtcgacttagaaggagactgcggtatcactttagtgcca
aaaccgcagactctgttatttaagtctcgtcgttga

DBGET integrated database retrieval system