Nasonia vitripennis (jewel wasp): 100120540 Help Entry 100120540         CDS       T01081                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism nvi  Nasonia vitripennis (jewel wasp) Pathway nvi04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:nvi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100120540  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nvi04121]     100120540    03400 DNA repair and recombination proteins [BR:nvi03400]     100120540 Ubiquitin system [BR:nvi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      100120540    Cul5 complex      100120540 DNA repair and recombination proteins [BR:nvi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      100120540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD DUF5101 Ubiquitin_2 Motif Other DBs NCBI-GeneID:  100120540 NCBI-ProteinID:  XP_001604175 NASONIABASE:  NV16800 UniProt:  A0A7M7G4Q0 LinkDB All DBs Position 4:22998880..23000876 Genome browser AA seq 117 aa AA seqDB search MDVFLMIRRKKMTIFTDAKENTTVLELKKIIEGILKIPPGNQQLFNKDNLLMSDNKCLSD YGLSSATAKAQCPAVIGLAIRQDNGQFEQLEMTPFSLPPDLPEVMKTQETNGQEQSP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtttttttaatgatacggcgaaagaaaatgacaatatttacggatgctaaggaa aatacaactgttctcgagttaaagaaaattatcgaaggaatattaaagatacctcctgga aatcaacagctattcaataaggataaccttcttatgtcagataacaaatgtttgtcagat tatgggctctcatcagctactgccaaagcacaatgcccagcagtgattgggttagctata cgtcaagataatggacaattcgagcaattagaaatgacgccattctctctacccccagat cttcctgaagtaatgaaaactcaagaaactaatggtcaagagcaatcaccatga

DBGET integrated database retrieval system