Nasonia vitripennis (jewel wasp): 100301486 Help Entry 100301486         CDS       T01081                                  Name (RefSeq) rho-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism nvi  Nasonia vitripennis (jewel wasp) Pathway nvi04013   MAPK signaling pathway - fly nvi04145   Phagosome nvi04148   Efferocytosis nvi04310   Wnt signaling pathway nvi04517   IgSF CAM signaling nvi04518   Integrin signaling nvi04620   Toll-like receptor signaling pathway nvi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nvi00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     100301486    04310 Wnt signaling pathway     100301486   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     100301486    04518 Integrin signaling     100301486  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100301486    04148 Efferocytosis     100301486  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100301486  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100301486  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nvi04131]     100301486   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nvi04147]     100301486    04031 GTP-binding proteins [BR:nvi04031]     100301486 Membrane trafficking [BR:nvi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     100301486  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     100301486   Macropinocytosis    Ras GTPases     100301486  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     100301486 Exosome [BR:nvi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100301486   Exosomal proteins of other body fluids (saliva and urine)    100301486   Exosomal proteins of colorectal cancer cells    100301486   Exosomal proteins of bladder cancer cells    100301486 GTP-binding proteins [BR:nvi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     100301486 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  100301486 NCBI-ProteinID:  NP_001153487 UniProt:  A0A7M7QSN3 LinkDB All DBs Position 2:6785719..6796788 Genome browser AA seq 196 aa AA seqDB search MGTGNGNEDKQSTMSRLRPIKITAVGDGMVGKTCMLITYTEKKFPMEYIPTVFENYPKKI EVDGHEYDATLWDTAGQEDYERLRPLSYPNTDCFLLCFSINARSSYENIASKWYPELKVH CPNIPIILIGTKSDLRAESDDIITPNECKKMKKKIRAFKYLECSAKMQEGLDEVFTEAVR AVLKRPSAARKLCCMI NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgggtaccggaaacggaaacgaagataaacaaagcacgatgtcccgactgaggccaata aaaatcacggcagtgggcgacggtatggtcggcaagacctgcatgctcatcacgtacaca gagaaaaagtttcccatggaatacatccccaccgtctttgagaactatccgaagaagata gaagtcgacggccacgagtacgacgccactctctgggataccgccggccaggaagattac gaaagactgaggcctttgtcctatcccaataccgactgctttctgctgtgcttctccata aacgcccggagttcttacgaaaacatagccagcaagtggtatcccgaactcaaagtccac tgtccgaatataccgataatccttattggcacaaaaagtgatctcagagctgagagcgac gatataataacaccgaatgaatgtaagaaaatgaaaaagaaaatccgcgctttcaagtac ctcgagtgctcggcgaagatgcaggagggcctggacgaggtctttaccgaggcggtgcgc gccgtcctgaaacggccgtccgccgcccgaaagctctgttgcatgatttaa

DBGET integrated database retrieval system