KEGG   Nicrophorus vespilloides (burying beetle): 108561833
Entry
108561833         CDS       T04922                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
nvl  Nicrophorus vespilloides (burying beetle)
Pathway
nvl00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    108561833
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nvl00199]
    108561833
Enzymes [BR:nvl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     108561833
Cytochrome P450 [BR:nvl00199]
 Cytochrome P450, animal type
  CYP306 family
   108561833
SSDB
Motif
Pfam: p450 R3H
Other DBs
NCBI-GeneID: 108561833
NCBI-ProteinID: XP_017775404
LinkDB
Position
Unknown
AA seq 493 aa
MGLMVIFMVVAIASAFWLWWQRRAATGMMALPPGPSGFPMFGYLPLLDAKAPHRTLAKLC
VKYGKVFGLHLGNVYTVVLSDARQIRKVLAMDAASGRAPLYLTHGIMKGYGLICAEGALW
KDQRRFVHSALKKFGMHKYSEKRKEIEALIRTEIDDCLKFIESDPLVSPEDVLRHNIGNV
INSLVFGVRYERDDPIWLWLQSLQEEGVKHIGVGGVLNFVPSFRFIPKFRKIFNYLLEGK
HKTHQVYREIIEKRKKSSKKLDGSNILEAFLLERSSTVGGKNEAFYTNQQFYHLLADVFG
AGLDTTLVTISWFFMFMAANPEEQAKVHKEIVEFAEAYQHPIDLNDLPYLPLLEAALSET
QRIRSVVPLGLPHGALRDIQLDDFIIPKGSMIVPFQWAIHMDPETYPDPETFRPDRFIDE
QGKFFKGEAFIPFQTGNRMCIGEDLAKMLMLLFSVEILRRFEIIAQGSLDLEGVTGITLA
PKRQLLLFKKRLE
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgggcctgatggttatttttatggtcgtggccatcgcctcggccttctggctgtggtgg
cagagacgcgcggctacggggatgatggccttaccgcctggaccctccggttttccgatg
ttcgggtatctgcctttgctggacgcgaaagctccgcaccgcaccctggctaagctttgc
gtcaagtacggaaaggttttcggtctgcacctgggtaacgtctatacggtggttctgagc
gatgctcgacagattcgaaaggttttggctatggacgcagcttcaggtcgcgcccctctg
tacctaacgcatgggatcatgaagggttacggtctcatctgtgccgagggcgctttgtgg
aaggaccagaggcgttttgtccactccgcgttgaagaagttcggaatgcataaatattct
gaaaagaggaaagaaatcgaggccctcatccgtacggagatcgacgattgtttgaaattt
atcgagagcgacccattggttagtccagaggatgtactgagacacaacatagggaacgtc
atcaatagcttggtctttggggttcggtatgaaagggacgaccctatttggctttggttg
caatcgctacaagaggaaggcgtcaagcacatcggcgtcggaggagttttgaatttcgtt
ccatcatttagatttattccgaaattccgtaaaatttttaattatttgcttgagggtaaa
cacaagacgcatcaggtctaccgcgagatcatcgagaagcgaaagaagtcttcgaaaaaa
ttggatggaagcaacatccttgaagctttccttctggaacgaagcagcacggttgggggt
aagaacgaggcgttttacacgaatcagcaattctaccaccttttggcggatgtcttcggg
gccggattagacacgactttggtcactataagctggttctttatgttcatggcggccaat
cccgaggagcaggccaaagttcataaggaaatcgtcgaatttgcggaagcctatcaacat
cccatcgatttaaacgatcttccgtatcttccgcttctggaagctgccctatccgagacc
caacgtatccgatccgtcgtaccgctgggtttaccgcacggtgccctccgcgacattcag
ctggacgattttatcatccccaaaggttcgatgatcgtccccttccaatgggcaatccac
atggaccctgagacgtaccccgatccggaaacgttccgaccggaccgcttcatcgacgag
caaggcaaattcttcaaaggcgaagccttcattcctttccaaacaggaaatcgaatgtgc
atcggggaggaccttgccaagatgctgatgctgctgttctcagtcgaaatccttcgacgt
ttcgaaatcattgctcagggaagcttggatttggaaggcgtcaccgggattactttggcg
ccgaaacggcaacttcttctgttcaagaaaaggcttgaataa

DBGET integrated database retrieval system