Natrinema versiforme: FEJ81_05400 Help Entry FEJ81_05400       CDS       T05974                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism nvr  Natrinema versiforme Pathway nvr03010   Ribosome Brite KEGG Orthology (KO) [BR:nvr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     FEJ81_05400   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     FEJ81_05400  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nvr03011]     FEJ81_05400    04121 Ubiquitin system [BR:nvr04121]     FEJ81_05400 Ribosome [BR:nvr03011]  Ribosomal proteins   Eukaryotes    Large subunit     FEJ81_05400   Archaea     FEJ81_05400 Ubiquitin system [BR:nvr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    FEJ81_05400 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR zf-CHY Ribosomal_L37e Zn_ribbon_RPAB4 Zn_ribbon_3 Zn_ribbon_GTF2H2 Motif Other DBs NCBI-ProteinID:  QCS41818 UniProt:  A0A4P8WEU9 LinkDB All DBs Position 1101451..1101600 Genome browser AA seq 49 aa AA seqDB search MASFDAAEKRMLEKMICMRCNARNSKRATRCRKCGYKKLRPKAKEARAA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggccagtttcgacgccgctgagaaacggatgctcgagaagatgatctgcatgcgctgt aacgctcgcaactccaagcgagccacccgctgtcgcaagtgcgggtacaagaagcttcgc cccaaggcgaaggaagcccgcgccgcataa

DBGET integrated database retrieval system