Neogale vison (American mink): 122890130 Help Entry 122890130         CDS       T08764                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism nvs  Neogale vison (American mink) Pathway nvs04060   Cytokine-cytokine receptor interaction nvs04061   Viral protein interaction with cytokine and cytokine receptor nvs04151   PI3K-Akt signaling pathway nvs04625   C-type lectin receptor signaling pathway nvs04630   JAK-STAT signaling pathway nvs04658   Th1 and Th2 cell differentiation nvs04659   Th17 cell differentiation nvs04660   T cell receptor signaling pathway nvs04672   Intestinal immune network for IgA production nvs04940   Type I diabetes mellitus nvs05135   Yersinia infection nvs05142   Chagas disease nvs05162   Measles nvs05166   Human T-cell leukemia virus 1 infection nvs05171   Coronavirus disease - COVID-19 nvs05200   Pathways in cancer nvs05320   Autoimmune thyroid disease nvs05321   Inflammatory bowel disease nvs05330   Allograft rejection nvs05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122890130 (IL2)    04151 PI3K-Akt signaling pathway     122890130 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122890130 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     122890130 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122890130 (IL2)    04660 T cell receptor signaling pathway     122890130 (IL2)    04658 Th1 and Th2 cell differentiation     122890130 (IL2)    04659 Th17 cell differentiation     122890130 (IL2)    04672 Intestinal immune network for IgA production     122890130 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122890130 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122890130 (IL2)    05171 Coronavirus disease - COVID-19     122890130 (IL2)    05162 Measles     122890130 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     122890130 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     122890130 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     122890130 (IL2)    05321 Inflammatory bowel disease     122890130 (IL2)    05330 Allograft rejection     122890130 (IL2)    05332 Graft-versus-host disease     122890130 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     122890130 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nvs04052]     122890130 (IL2)    00536 Glycosaminoglycan binding proteins [BR:nvs00536]     122890130 (IL2) Cytokines and neuropeptides [BR:nvs04052]  Cytokines   Interleukins    122890130 (IL2) Glycosaminoglycan binding proteins [BR:nvs00536]  Heparan sulfate / Heparin   Cytokines    122890130 (IL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL2 Motif Other DBs NCBI-GeneID:  122890130 NCBI-ProteinID:  XP_044081788 LinkDB All DBs Position 11:88054970..88059853 Genome browser AA seq 155 aa AA seqDB search MYKMQLLSCIVLTLALVANSAPTTSSSAKEAQQQLEQLLLDLQLLLNGVNNYESLKLPRM LTFKFYMPKKATELTHLQCLAEELKLLEEVLYLAQSKNFHLTDIKELMSNINVTLLKLKG SETSFKCEYDDETVTITEFLNKWITFCQSIFSTLT NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaatgcaactcttgtcttgcatcgtactgactctcgcactcgtcgcaaacagt gcacctactacttcaagctctgcgaaggaagcacagcaacagctggagcaattgctgctg gacttacagttgctcttgaatggagttaataattatgagagcctcaaactccccaggatg ctcacgtttaaattctacatgcccaagaaggccacagaattgactcatcttcaatgtcta gcagaagaactcaaacttttggaggaagtgctatatttagctcaaagcaaaaactttcac ttgacagacatcaaggaactaatgagcaatatcaatgtaacacttctgaaactaaaggga tctgaaacaagtttcaaatgtgaatatgatgacgagacagtaaccattacagaatttctg aacaaatggattactttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system