Neogale vison (American mink): 122890243 Help Entry 122890243         CDS       T08764                                  Symbol MYL5 Name (RefSeq) myosin light chain 5   KO K12753   myosin regulatory light chain 5 Organism nvs  Neogale vison (American mink) Pathway nvs04360   Axon guidance nvs04510   Focal adhesion nvs04520   Adherens junction nvs04670   Leukocyte transendothelial migration nvs04810   Regulation of actin cytoskeleton nvs04814   Motor proteins nvs04820   Cytoskeleton in muscle cells nvs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nvs00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     122890243 (MYL5)    04520 Adherens junction     122890243 (MYL5)   09142 Cell motility    04814 Motor proteins     122890243 (MYL5)    04820 Cytoskeleton in muscle cells     122890243 (MYL5)    04810 Regulation of actin cytoskeleton     122890243 (MYL5)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     122890243 (MYL5)   09158 Development and regeneration    04360 Axon guidance     122890243 (MYL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122890243 (MYL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:nvs04812]     122890243 (MYL5) Cytoskeleton proteins [BR:nvs04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      122890243 (MYL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 CFAP251_C EF_EFCAB10_C SAPC2_N EF_SSP120 AIF-1 EFhand_Ca_insen EF-hand_FSTL1 EF-hand_9 Caleosin Motif Other DBs NCBI-GeneID:  122890243 NCBI-ProteinID:  XP_044081887 LinkDB All DBs Position 11:complement(68879190..68882298) Genome browser AA seq 186 aa AA seqDB search MRVLVFTVEGSLEQASRKTKKKEGGGLRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRD GFIDKEDLKDTYASLGKTNIKDDELDAMLKEASGPINFTMFLNMFGAKLTGTDTEETILN AFKMLDPDGKGSINKDYIKRLLMSQADKMTAEEVDQMFQFATIDAAGNLDYKALSYVLTH GEEKEE NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgagggtcctggtcttcacagtggaagggtccctagaacaggccagcaggaagactaag aagaaggaaggggggggcctacgggcccagagggcatcatccaacgtcttctccaacttt gagcagacccagatccaggagttcaaggaggcattcacactaatggatcagaaccgagat ggctttatcgacaaggaggacctaaaggacacctacgcctcactgggcaaaaccaacatc aaggatgacgagctggatgccatgctcaaggaagcctcggggcccatcaacttcaccatg ttcctgaatatgtttggggcaaagctgacaggtacggatactgaggagaccatcttaaac gccttcaagatgctggatcctgatggcaaaggcagcatcaacaaggactacatcaagcgg ctgttgatgtcccaggcagacaagatgaccgccgaagaggtggaccagatgttccagttt gctaccatcgatgctgcaggcaacctggactataaggcattgagctacgtgctcacccac ggggaggagaaggaggagtga

DBGET integrated database retrieval system