Neogale vison (American mink): 122892062 Help Entry 122892062         CDS       T08764                                  Name (RefSeq) histone H2A.J   KO K11251   histone H2A Organism nvs  Neogale vison (American mink) Pathway nvs03082   ATP-dependent chromatin remodeling nvs04217   Necroptosis nvs04613   Neutrophil extracellular trap formation nvs05034   Alcoholism nvs05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:nvs00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     122892062  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122892062  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122892062  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     122892062   09165 Substance dependence    05034 Alcoholism     122892062  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nvs03036]     122892062   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nvs04147]     122892062 Chromosome and associated proteins [BR:nvs03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122892062 Exosome [BR:nvs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122892062 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  122892062 NCBI-ProteinID:  XP_044084140 LinkDB All DBs Position 12:58091448..58092122 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESQKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggaaagcagggcggcaaagtgcgggccaaggccaagtctcggtcctcc cgcgcgggcctgcagttcccggtgggccgagttcacagactgctgcgcaaaggtaactac gcggagcgagtgggcgctggggcgcccgtatacctggcggcggtgttggagtacctgacc gccgagatcctggagttggctggcaatgccgctcgtgacaacaagaagaccaggataatc ccgcgccacctgcaactcgccatccgcaacgacgaggagctcaacaagctgctggggaaa gtcaccattgctcagggcggtgtcctgcccaacatccaggccgtgctgttgcccaagaag acggagagtcagaaggcgaagagcaagtga

DBGET integrated database retrieval system