Neogale vison (American mink): 122893621 Help Entry 122893621         CDS       T08764                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism nvs  Neogale vison (American mink) Pathway nvs04024   cAMP signaling pathway nvs04062   Chemokine signaling pathway nvs04064   NF-kappa B signaling pathway nvs04210   Apoptosis nvs04380   Osteoclast differentiation nvs04519   Cadherin signaling nvs04620   Toll-like receptor signaling pathway nvs04621   NOD-like receptor signaling pathway nvs04622   RIG-I-like receptor signaling pathway nvs04623   Cytosolic DNA-sensing pathway nvs04625   C-type lectin receptor signaling pathway nvs04657   IL-17 signaling pathway nvs04658   Th1 and Th2 cell differentiation nvs04659   Th17 cell differentiation nvs04660   T cell receptor signaling pathway nvs04662   B cell receptor signaling pathway nvs04668   TNF signaling pathway nvs04722   Neurotrophin signaling pathway nvs04920   Adipocytokine signaling pathway nvs04926   Relaxin signaling pathway nvs04931   Insulin resistance nvs04936   Alcoholic liver disease nvs05132   Salmonella infection nvs05134   Legionellosis nvs05135   Yersinia infection nvs05140   Leishmaniasis nvs05142   Chagas disease nvs05145   Toxoplasmosis nvs05160   Hepatitis C nvs05161   Hepatitis B nvs05162   Measles nvs05163   Human cytomegalovirus infection nvs05164   Influenza A nvs05166   Human T-cell leukemia virus 1 infection nvs05167   Kaposi sarcoma-associated herpesvirus infection nvs05168   Herpes simplex virus 1 infection nvs05169   Epstein-Barr virus infection nvs05170   Human immunodeficiency virus 1 infection nvs05171   Coronavirus disease nvs05200   Pathways in cancer nvs05203   Viral carcinogenesis nvs05208   Chemical carcinogenesis - reactive oxygen species nvs05215   Prostate cancer nvs05220   Chronic myeloid leukemia nvs05222   Small cell lung cancer nvs05235   PD-L1 expression and PD-1 checkpoint pathway in cancer nvs05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     122893621 (NFKBIA)    04668 TNF signaling pathway     122893621 (NFKBIA)    04024 cAMP signaling pathway     122893621 (NFKBIA)   09133 Signaling molecules and interaction    04519 Cadherin signaling     122893621 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     122893621 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122893621 (NFKBIA)    04621 NOD-like receptor signaling pathway     122893621 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     122893621 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     122893621 (NFKBIA)    04625 C-type lectin receptor signaling pathway     122893621 (NFKBIA)    04660 T cell receptor signaling pathway     122893621 (NFKBIA)    04658 Th1 and Th2 cell differentiation     122893621 (NFKBIA)    04659 Th17 cell differentiation     122893621 (NFKBIA)    04657 IL-17 signaling pathway     122893621 (NFKBIA)    04662 B cell receptor signaling pathway     122893621 (NFKBIA)    04062 Chemokine signaling pathway     122893621 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     122893621 (NFKBIA)    04926 Relaxin signaling pathway     122893621 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     122893621 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     122893621 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122893621 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     122893621 (NFKBIA)    05203 Viral carcinogenesis     122893621 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     122893621 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     122893621 (NFKBIA)    05215 Prostate cancer     122893621 (NFKBIA)    05222 Small cell lung cancer     122893621 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122893621 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     122893621 (NFKBIA)    05161 Hepatitis B     122893621 (NFKBIA)    05160 Hepatitis C     122893621 (NFKBIA)    05171 Coronavirus disease     122893621 (NFKBIA)    05164 Influenza A     122893621 (NFKBIA)    05162 Measles     122893621 (NFKBIA)    05168 Herpes simplex virus 1 infection     122893621 (NFKBIA)    05163 Human cytomegalovirus infection     122893621 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     122893621 (NFKBIA)    05169 Epstein-Barr virus infection     122893621 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     122893621 (NFKBIA)    05135 Yersinia infection     122893621 (NFKBIA)    05134 Legionellosis     122893621 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     122893621 (NFKBIA)    05140 Leishmaniasis     122893621 (NFKBIA)    05142 Chagas disease     122893621 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122893621 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122893621 (NFKBIA)    04931 Insulin resistance     122893621 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:nvs03000]     122893621 (NFKBIA)    04131 Membrane trafficking [BR:nvs04131]     122893621 (NFKBIA) Transcription factors [BR:nvs03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     122893621 (NFKBIA) Membrane trafficking [BR:nvs04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     122893621 (NFKBIA) SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  122893621 NCBI-ProteinID:  XP_044086701 UniProt:  A0A8C7A4A0 LinkDB All DBs Position 13:62276973..62280259 Genome browser AA seq 314 aa AA seqDB search MFQAAEHNQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQLVKELKEIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLSSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcaggccgccgagcacaaccaggactgggccatggagggtccccgggacgcgctc aagaaggagcgcctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgaacagttggtgaaggaactgaaggagatccgcctcgagccgcaggaggcgccg cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcactgaccatggaagtgatccgccaagtgaagggcgac ctggcctttctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccaaccagaaattgctgaggcacttctgggagctggctgtgatcctgagctcaga gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctggccagtgtg ggagtcctgactcagacctgcaggacccagcacctctcctccatcctccaggccactaac tacaatgggcacacgtgtctacatttagcctctatccatggttacttgggcattgtggaa cttctggtgtctctgggtgctgacgtcaatgctcaggagccctgcaatggccgaaccgcc ctccatctcgccgtggacctgcagaattctgatctcgtgtcactcttgttgaagtgtggg gctgatgtcaacagagttacctaccagggctattccccataccagctcacctggggccgc ccaagcacgcggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagcgaggatgaggagagctatgacacggagtcagagttcacggaggacgagctg ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system