Neogale vison (American mink): 122896446 Help Entry 122896446         CDS       T08764                                  Name (RefSeq) ADP-ribosylation factor 1-like   KO K07937   ADP-ribosylation factor 1/2 Organism nvs  Neogale vison (American mink) Pathway nvs04072   Phospholipase D signaling pathway nvs04144   Endocytosis nvs05132   Salmonella infection nvs05134   Legionellosis Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     122896446  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122896446  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122896446    05134 Legionellosis     122896446  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nvs04131]     122896446   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nvs04147]     122896446    04031 GTP-binding proteins [BR:nvs04031]     122896446 Membrane trafficking [BR:nvs04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     122896446   Arf GTPases and associated proteins    Arf GTPases     122896446  Endosome - Golgi transport     122896446 Exosome [BR:nvs04147]  Exosomal proteins   Proteins found in most exosomes    122896446 GTP-binding proteins [BR:nvs04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     122896446 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc G-alpha Ras Gtr1_RagA Motif Other DBs NCBI-GeneID:  122896446 NCBI-ProteinID:  XP_044090585 LinkDB All DBs Position X:complement(9999106..9999507) Genome browser AA seq 133 aa AA seqDB search MGNIFSNLFKGFFGKKEMRMHSHGGLGCCRRTTIPYKQKLGEIVATVPTVGFTVETMETM EDKTISLTVWDSGGQDKAPPLWHHRFQNTQGLIFTADRSDREQDLPNTTNAAEITDRLGL RSLHPRNWYSQAT NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgggaaatatcttctcgaacctctttaagggcttttttggcaaaaaagaaatgcgcatg cattctcatggtgggcttggatgttgcagaaggaccaccatcccgtacaaacagaagctg ggtgagatcgtggccaccgttcccaccgtaggcttcactgtggaaaccatggaaaccatg gaggacaagaccatcagcctcaccgtgtgggactcaggtggccaggacaaggccccgccc ctgtggcaccaccgcttccagaacacacaaggtctcatcttcacagccgacagaagtgac agagagcaggacctccccaacaccacgaatgcagcggagatcacggacaggctggggctg cgctccctgcaccccaggaactggtacagtcaggccacctga

DBGET integrated database retrieval system