Neogale vison (American mink): 122896459 Help Entry 122896459         CDS       T08764                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism nvs  Neogale vison (American mink) Pathway nvs04382   Cornified envelope formation nvs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nvs00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     122896459  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122896459  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nvs04147]     122896459 Exosome [BR:nvs04147]  Exosomal proteins   Exosomal proteins of microglial cells    122896459 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 Motif Other DBs NCBI-GeneID:  122896459 NCBI-ProteinID:  XP_044090601 LinkDB All DBs Position X:complement(126263750..126264140) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLNAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacatgccatggaaaccatgatgttcacatttcacaagtttgct ggtgataaaggctacttaacaaaggaggacctgcgagtactcatggaaaaggagttccct ggatttttggaaaatcagaaagaccctctggccgtggacaaaataatgaaggaccttgac cagtgccgagatggcaaagtgggcttccagagcttcttctcgctaaacgcagggctcacc attgcatgcaatgactattttgtagtacacatgaagcagaagggaaagaaatag

DBGET integrated database retrieval system