Neogale vison (American mink): 122900023 Help Entry 122900023         CDS       T08764                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism nvs  Neogale vison (American mink) Pathway nvs01522   Endocrine resistance nvs04010   MAPK signaling pathway nvs04012   ErbB signaling pathway nvs04024   cAMP signaling pathway nvs04137   Mitophagy - animal nvs04210   Apoptosis nvs04310   Wnt signaling pathway nvs04380   Osteoclast differentiation nvs04510   Focal adhesion nvs04530   Tight junction nvs04620   Toll-like receptor signaling pathway nvs04621   NOD-like receptor signaling pathway nvs04625   C-type lectin receptor signaling pathway nvs04657   IL-17 signaling pathway nvs04658   Th1 and Th2 cell differentiation nvs04659   Th17 cell differentiation nvs04660   T cell receptor signaling pathway nvs04662   B cell receptor signaling pathway nvs04668   TNF signaling pathway nvs04722   Neurotrophin signaling pathway nvs04912   GnRH signaling pathway nvs04915   Estrogen signaling pathway nvs04921   Oxytocin signaling pathway nvs04926   Relaxin signaling pathway nvs04932   Non-alcoholic fatty liver disease nvs04933   AGE-RAGE signaling pathway in diabetic complications nvs05030   Cocaine addiction nvs05031   Amphetamine addiction nvs05132   Salmonella infection nvs05133   Pertussis nvs05135   Yersinia infection nvs05140   Leishmaniasis nvs05142   Chagas disease nvs05161   Hepatitis B nvs05162   Measles nvs05166   Human T-cell leukemia virus 1 infection nvs05167   Kaposi sarcoma-associated herpesvirus infection nvs05169   Epstein-Barr virus infection nvs05170   Human immunodeficiency virus 1 infection nvs05171   Coronavirus disease - COVID-19 nvs05200   Pathways in cancer nvs05203   Viral carcinogenesis nvs05207   Chemical carcinogenesis - receptor activation nvs05208   Chemical carcinogenesis - reactive oxygen species nvs05210   Colorectal cancer nvs05211   Renal cell carcinoma nvs05224   Breast cancer nvs05231   Choline metabolism in cancer nvs05235   PD-L1 expression and PD-1 checkpoint pathway in cancer nvs05321   Inflammatory bowel disease nvs05323   Rheumatoid arthritis nvs05417   Lipid and atherosclerosis nvs05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122900023 (JUN)    04012 ErbB signaling pathway     122900023 (JUN)    04310 Wnt signaling pathway     122900023 (JUN)    04668 TNF signaling pathway     122900023 (JUN)    04024 cAMP signaling pathway     122900023 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     122900023 (JUN)   09143 Cell growth and death    04210 Apoptosis     122900023 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     122900023 (JUN)    04530 Tight junction     122900023 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122900023 (JUN)    04621 NOD-like receptor signaling pathway     122900023 (JUN)    04625 C-type lectin receptor signaling pathway     122900023 (JUN)    04660 T cell receptor signaling pathway     122900023 (JUN)    04658 Th1 and Th2 cell differentiation     122900023 (JUN)    04659 Th17 cell differentiation     122900023 (JUN)    04657 IL-17 signaling pathway     122900023 (JUN)    04662 B cell receptor signaling pathway     122900023 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     122900023 (JUN)    04915 Estrogen signaling pathway     122900023 (JUN)    04921 Oxytocin signaling pathway     122900023 (JUN)    04926 Relaxin signaling pathway     122900023 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     122900023 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     122900023 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122900023 (JUN)    05207 Chemical carcinogenesis - receptor activation     122900023 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     122900023 (JUN)    05203 Viral carcinogenesis     122900023 (JUN)    05231 Choline metabolism in cancer     122900023 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     122900023 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     122900023 (JUN)    05211 Renal cell carcinoma     122900023 (JUN)    05224 Breast cancer     122900023 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122900023 (JUN)    05170 Human immunodeficiency virus 1 infection     122900023 (JUN)    05161 Hepatitis B     122900023 (JUN)    05171 Coronavirus disease - COVID-19     122900023 (JUN)    05162 Measles     122900023 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     122900023 (JUN)    05169 Epstein-Barr virus infection     122900023 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     122900023 (JUN)    05135 Yersinia infection     122900023 (JUN)    05133 Pertussis     122900023 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     122900023 (JUN)    05142 Chagas disease     122900023 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     122900023 (JUN)    05321 Inflammatory bowel disease     122900023 (JUN)   09165 Substance dependence    05030 Cocaine addiction     122900023 (JUN)    05031 Amphetamine addiction     122900023 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122900023 (JUN)    05418 Fluid shear stress and atherosclerosis     122900023 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     122900023 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     122900023 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     122900023 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:nvs03000]     122900023 (JUN) Transcription factors [BR:nvs03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     122900023 (JUN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch TFIIA Motif Other DBs NCBI-GeneID:  122900023 NCBI-ProteinID:  XP_044094274 UniProt:  A0A8C7AV94 LinkDB All DBs Position 2:complement(47950222..47952911) Genome browser AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQLPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctgaatgcctcgttcctccag tctgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagtatgaccctg aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctc ctcacctcacccgacgtggggctgctcaagctggcctcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgacccccacgcagttcttgtgccct aaaaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg ggcatggtggctccggcagtggcttcggcggcgggtggcagcggcagcggcggcttcagt gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaaccccggcgcg ctgagcagcggcggcggggcgccctcctacggcgctgccggcctggcctttcccgcgcag ccccagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagctccccgtg cagcacccgcggctgcaggccttgaaggaggagccgcagacggtgcccgagatgcccggg gaaacgccgcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcagagagg aagcgcatgaggaaccgcatagctgcctccaagtgccggaaaaggaagctggagaggatc gcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system