Neogale vison (American mink): 122901781 Help Entry 122901781         CDS       T08764                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism nvs  Neogale vison (American mink) Pathway nvs04015   Rap1 signaling pathway nvs04810   Regulation of actin cytoskeleton nvs05014   Amyotrophic lateral sclerosis nvs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     122901781 (PFN3)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     122901781 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nvs04131]     122901781 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:nvs04812]     122901781 (PFN3)    04147 Exosome [BR:nvs04147]     122901781 (PFN3) Membrane trafficking [BR:nvs04131]  Others   Actin-binding proteins    Others     122901781 (PFN3) Cytoskeleton proteins [BR:nvs04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      122901781 (PFN3) Exosome [BR:nvs04147]  Exosomal proteins   Proteins found in most exosomes    122901781 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  122901781 NCBI-ProteinID:  XP_044096829 LinkDB All DBs Position 1:251418608..251419021 Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGHDRRTFL QSGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRVLLVLMGRRGVHGGI LNKTVHELIKGLRKQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggagactggaagggctatatcagtgcggtgttgcgtgaccagcgcattgacgacgtg gccatcgtgggtcactcagacaatcgctgcgtgtgggcatcgcgccccggaggccttctg gctgccatatcgccgcaggaggtgggtgtgctcacagggcatgaccggcgcaccttcctg cagtcgggcctcagcgtggcgggccgccgctgctgcgtcatccgcgaccacttgctgtct gagggcgatggagttctggacgcgcgcaccaaggggctggatgggcgcgcggtctgcgtc ggccacaccccgcgcgtgcttctcgtgctcatgggccggcgcggcgtgcacgggggcatc ctcaataagacggtgcatgaactgatcaagggtctgcgcaagcagggcacctag

DBGET integrated database retrieval system