Neogale vison (American mink): 122902885 Help Entry 122902885         CDS       T08764                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism nvs  Neogale vison (American mink) Pathway nvs04145   Phagocytosis nvs04814   Motor proteins nvs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nvs00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     122902885 (DYNLT1)   09142 Cell motility    04814 Motor proteins     122902885 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122902885 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:nvs03037]     122902885 (DYNLT1)    04812 Cytoskeleton proteins [BR:nvs04812]     122902885 (DYNLT1) Cilium and associated proteins [BR:nvs03037]  Motile cilia and associated proteins   Dynein arm    122902885 (DYNLT1) Cytoskeleton proteins [BR:nvs04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      122902885 (DYNLT1) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  122902885 NCBI-ProteinID:  XP_044098938 LinkDB All DBs Position 1:8932360..8939982 Genome browser AA seq 113 aa AA seqDB search MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccaggctgcggaggagactgcttttgtcgtggatgaagtgagcaacatt gtaaaagaggctatcgagagcgcgatcggcggcaatgcctaccagcacagcaaagtcaat cagtggaccacaaacgtagtagaacaaactttaagccaactcaccaagctgggaaagcca tttaagtacatcgtgacctgtgtgattatgcagaagaacggagccgggctgcacacggcg agttcctgcttctgggacagctctacggacggcagctgcaccgtgcggtgggagaacaag accatgtactgcatcgtcagcgccttcgggctgtccatctga

DBGET integrated database retrieval system