KEGG   Neogale vison (American mink): 122903200
Entry
122903200         CDS       T08764                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
nvs  Neogale vison (American mink)
Pathway
nvs01521  EGFR tyrosine kinase inhibitor resistance
nvs01522  Endocrine resistance
nvs01524  Platinum drug resistance
nvs04010  MAPK signaling pathway
nvs04012  ErbB signaling pathway
nvs04014  Ras signaling pathway
nvs04015  Rap1 signaling pathway
nvs04022  cGMP-PKG signaling pathway
nvs04024  cAMP signaling pathway
nvs04062  Chemokine signaling pathway
nvs04066  HIF-1 signaling pathway
nvs04068  FoxO signaling pathway
nvs04071  Sphingolipid signaling pathway
nvs04072  Phospholipase D signaling pathway
nvs04114  Oocyte meiosis
nvs04140  Autophagy - animal
nvs04148  Efferocytosis
nvs04150  mTOR signaling pathway
nvs04151  PI3K-Akt signaling pathway
nvs04210  Apoptosis
nvs04218  Cellular senescence
nvs04261  Adrenergic signaling in cardiomyocytes
nvs04270  Vascular smooth muscle contraction
nvs04350  TGF-beta signaling pathway
nvs04360  Axon guidance
nvs04370  VEGF signaling pathway
nvs04371  Apelin signaling pathway
nvs04380  Osteoclast differentiation
nvs04510  Focal adhesion
nvs04517  IgSF CAM signaling
nvs04520  Adherens junction
nvs04540  Gap junction
nvs04550  Signaling pathways regulating pluripotency of stem cells
nvs04611  Platelet activation
nvs04613  Neutrophil extracellular trap formation
nvs04620  Toll-like receptor signaling pathway
nvs04621  NOD-like receptor signaling pathway
nvs04625  C-type lectin receptor signaling pathway
nvs04650  Natural killer cell mediated cytotoxicity
nvs04657  IL-17 signaling pathway
nvs04658  Th1 and Th2 cell differentiation
nvs04659  Th17 cell differentiation
nvs04660  T cell receptor signaling pathway
nvs04662  B cell receptor signaling pathway
nvs04664  Fc epsilon RI signaling pathway
nvs04666  Fc gamma R-mediated phagocytosis
nvs04668  TNF signaling pathway
nvs04713  Circadian entrainment
nvs04720  Long-term potentiation
nvs04722  Neurotrophin signaling pathway
nvs04723  Retrograde endocannabinoid signaling
nvs04724  Glutamatergic synapse
nvs04725  Cholinergic synapse
nvs04726  Serotonergic synapse
nvs04730  Long-term depression
nvs04810  Regulation of actin cytoskeleton
nvs04910  Insulin signaling pathway
nvs04912  GnRH signaling pathway
nvs04914  Progesterone-mediated oocyte maturation
nvs04915  Estrogen signaling pathway
nvs04916  Melanogenesis
nvs04917  Prolactin signaling pathway
nvs04919  Thyroid hormone signaling pathway
nvs04921  Oxytocin signaling pathway
nvs04926  Relaxin signaling pathway
nvs04928  Parathyroid hormone synthesis, secretion and action
nvs04929  GnRH secretion
nvs04930  Type II diabetes mellitus
nvs04933  AGE-RAGE signaling pathway in diabetic complications
nvs04934  Cushing syndrome
nvs04935  Growth hormone synthesis, secretion and action
nvs04960  Aldosterone-regulated sodium reabsorption
nvs05010  Alzheimer disease
nvs05020  Prion disease
nvs05022  Pathways of neurodegeneration - multiple diseases
nvs05034  Alcoholism
nvs05132  Salmonella infection
nvs05133  Pertussis
nvs05135  Yersinia infection
nvs05140  Leishmaniasis
nvs05142  Chagas disease
nvs05145  Toxoplasmosis
nvs05152  Tuberculosis
nvs05160  Hepatitis C
nvs05161  Hepatitis B
nvs05163  Human cytomegalovirus infection
nvs05164  Influenza A
nvs05165  Human papillomavirus infection
nvs05166  Human T-cell leukemia virus 1 infection
nvs05167  Kaposi sarcoma-associated herpesvirus infection
nvs05170  Human immunodeficiency virus 1 infection
nvs05171  Coronavirus disease - COVID-19
nvs05200  Pathways in cancer
nvs05203  Viral carcinogenesis
nvs05205  Proteoglycans in cancer
nvs05206  MicroRNAs in cancer
nvs05207  Chemical carcinogenesis - receptor activation
nvs05208  Chemical carcinogenesis - reactive oxygen species
nvs05210  Colorectal cancer
nvs05211  Renal cell carcinoma
nvs05212  Pancreatic cancer
nvs05213  Endometrial cancer
nvs05214  Glioma
nvs05215  Prostate cancer
nvs05216  Thyroid cancer
nvs05218  Melanoma
nvs05219  Bladder cancer
nvs05220  Chronic myeloid leukemia
nvs05221  Acute myeloid leukemia
nvs05223  Non-small cell lung cancer
nvs05224  Breast cancer
nvs05225  Hepatocellular carcinoma
nvs05226  Gastric cancer
nvs05230  Central carbon metabolism in cancer
nvs05231  Choline metabolism in cancer
nvs05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nvs05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nvs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    122903200 (MAPK1)
   04012 ErbB signaling pathway
    122903200 (MAPK1)
   04014 Ras signaling pathway
    122903200 (MAPK1)
   04015 Rap1 signaling pathway
    122903200 (MAPK1)
   04350 TGF-beta signaling pathway
    122903200 (MAPK1)
   04370 VEGF signaling pathway
    122903200 (MAPK1)
   04371 Apelin signaling pathway
    122903200 (MAPK1)
   04668 TNF signaling pathway
    122903200 (MAPK1)
   04066 HIF-1 signaling pathway
    122903200 (MAPK1)
   04068 FoxO signaling pathway
    122903200 (MAPK1)
   04072 Phospholipase D signaling pathway
    122903200 (MAPK1)
   04071 Sphingolipid signaling pathway
    122903200 (MAPK1)
   04024 cAMP signaling pathway
    122903200 (MAPK1)
   04022 cGMP-PKG signaling pathway
    122903200 (MAPK1)
   04151 PI3K-Akt signaling pathway
    122903200 (MAPK1)
   04150 mTOR signaling pathway
    122903200 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    122903200 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    122903200 (MAPK1)
   04148 Efferocytosis
    122903200 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    122903200 (MAPK1)
   04210 Apoptosis
    122903200 (MAPK1)
   04218 Cellular senescence
    122903200 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    122903200 (MAPK1)
   04520 Adherens junction
    122903200 (MAPK1)
   04540 Gap junction
    122903200 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    122903200 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    122903200 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    122903200 (MAPK1)
   04613 Neutrophil extracellular trap formation
    122903200 (MAPK1)
   04620 Toll-like receptor signaling pathway
    122903200 (MAPK1)
   04621 NOD-like receptor signaling pathway
    122903200 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    122903200 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    122903200 (MAPK1)
   04660 T cell receptor signaling pathway
    122903200 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    122903200 (MAPK1)
   04659 Th17 cell differentiation
    122903200 (MAPK1)
   04657 IL-17 signaling pathway
    122903200 (MAPK1)
   04662 B cell receptor signaling pathway
    122903200 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    122903200 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    122903200 (MAPK1)
   04062 Chemokine signaling pathway
    122903200 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    122903200 (MAPK1)
   04929 GnRH secretion
    122903200 (MAPK1)
   04912 GnRH signaling pathway
    122903200 (MAPK1)
   04915 Estrogen signaling pathway
    122903200 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    122903200 (MAPK1)
   04917 Prolactin signaling pathway
    122903200 (MAPK1)
   04921 Oxytocin signaling pathway
    122903200 (MAPK1)
   04926 Relaxin signaling pathway
    122903200 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    122903200 (MAPK1)
   04919 Thyroid hormone signaling pathway
    122903200 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    122903200 (MAPK1)
   04916 Melanogenesis
    122903200 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    122903200 (MAPK1)
   04270 Vascular smooth muscle contraction
    122903200 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    122903200 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    122903200 (MAPK1)
   04725 Cholinergic synapse
    122903200 (MAPK1)
   04726 Serotonergic synapse
    122903200 (MAPK1)
   04720 Long-term potentiation
    122903200 (MAPK1)
   04730 Long-term depression
    122903200 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    122903200 (MAPK1)
   04722 Neurotrophin signaling pathway
    122903200 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    122903200 (MAPK1)
   04380 Osteoclast differentiation
    122903200 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    122903200 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    122903200 (MAPK1)
   05206 MicroRNAs in cancer
    122903200 (MAPK1)
   05205 Proteoglycans in cancer
    122903200 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    122903200 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    122903200 (MAPK1)
   05203 Viral carcinogenesis
    122903200 (MAPK1)
   05230 Central carbon metabolism in cancer
    122903200 (MAPK1)
   05231 Choline metabolism in cancer
    122903200 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    122903200 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    122903200 (MAPK1)
   05212 Pancreatic cancer
    122903200 (MAPK1)
   05225 Hepatocellular carcinoma
    122903200 (MAPK1)
   05226 Gastric cancer
    122903200 (MAPK1)
   05214 Glioma
    122903200 (MAPK1)
   05216 Thyroid cancer
    122903200 (MAPK1)
   05221 Acute myeloid leukemia
    122903200 (MAPK1)
   05220 Chronic myeloid leukemia
    122903200 (MAPK1)
   05218 Melanoma
    122903200 (MAPK1)
   05211 Renal cell carcinoma
    122903200 (MAPK1)
   05219 Bladder cancer
    122903200 (MAPK1)
   05215 Prostate cancer
    122903200 (MAPK1)
   05213 Endometrial cancer
    122903200 (MAPK1)
   05224 Breast cancer
    122903200 (MAPK1)
   05223 Non-small cell lung cancer
    122903200 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    122903200 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    122903200 (MAPK1)
   05161 Hepatitis B
    122903200 (MAPK1)
   05160 Hepatitis C
    122903200 (MAPK1)
   05171 Coronavirus disease - COVID-19
    122903200 (MAPK1)
   05164 Influenza A
    122903200 (MAPK1)
   05163 Human cytomegalovirus infection
    122903200 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    122903200 (MAPK1)
   05165 Human papillomavirus infection
    122903200 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    122903200 (MAPK1)
   05135 Yersinia infection
    122903200 (MAPK1)
   05133 Pertussis
    122903200 (MAPK1)
   05152 Tuberculosis
    122903200 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    122903200 (MAPK1)
   05140 Leishmaniasis
    122903200 (MAPK1)
   05142 Chagas disease
    122903200 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122903200 (MAPK1)
   05020 Prion disease
    122903200 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    122903200 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    122903200 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    122903200 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    122903200 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    122903200 (MAPK1)
   04934 Cushing syndrome
    122903200 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    122903200 (MAPK1)
   01524 Platinum drug resistance
    122903200 (MAPK1)
   01522 Endocrine resistance
    122903200 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvs01001]
    122903200 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nvs03036]
    122903200 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvs04147]
    122903200 (MAPK1)
Enzymes [BR:nvs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     122903200 (MAPK1)
Protein kinases [BR:nvs01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   122903200 (MAPK1)
Chromosome and associated proteins [BR:nvs03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     122903200 (MAPK1)
Exosome [BR:nvs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   122903200 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 122903200
NCBI-ProteinID: XP_044099717
UniProt: A0A8C7EWC8
LinkDB
Position
3:complement(213489906..213603212)
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgat
gtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgacattattcgagcaccaaccattgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctctacaagctcttgaagacgcaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatc
cattcagctaatgtactgcatcgtgacctcaaaccttccaacctgctgctcaacaccacc
tgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccagaccatgatcac
acagggttcctgacggagtatgtagccacacgttggtacagggctccagaaatcatgttg
aattccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagag
atgctgtccaacaggcccatcttcccggggaagcattatctcgaccagctgaaccacatt
ctgggtattcttggatccccatcacaggaagacctgaactgtataataaatttaaaagct
agaaactacttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgattccaaagctctggatttactggacaaaatgttgacattcaaccctcacaag
aggattgaagtagaacaggctctggcccatccatatctggagcagtattatgacccaagt
gatgagcccatcgctgaggcaccattcaagtttgacatggagctggacgacctgcccaag
gaaaagctcaaagagctcatcttcgaagagacagctagattccagccgggatacagatct
taa

DBGET integrated database retrieval system