Neogale vison (American mink): 122904378
Help
Entry
122904378 CDS
T08764
Name
(RefSeq) S-phase kinase-associated protein 1-like
KO
K03094
S-phase kinase-associated protein 1
Organism
nvs
Neogale vison (American mink)
Pathway
nvs03083
Polycomb repressive complex
nvs04110
Cell cycle
nvs04114
Oocyte meiosis
nvs04120
Ubiquitin mediated proteolysis
nvs04141
Protein processing in endoplasmic reticulum
nvs04310
Wnt signaling pathway
nvs04350
TGF-beta signaling pathway
nvs04710
Circadian rhythm
nvs05132
Salmonella infection
nvs05170
Human immunodeficiency virus 1 infection
nvs05200
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:
nvs00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
122904378
04120 Ubiquitin mediated proteolysis
122904378
09126 Chromosome
03083 Polycomb repressive complex
122904378
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
122904378
04350 TGF-beta signaling pathway
122904378
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
122904378
04114 Oocyte meiosis
122904378
09150 Organismal Systems
09159 Environmental adaptation
04710 Circadian rhythm
122904378
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
122904378
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
122904378
09171 Infectious disease: bacterial
05132 Salmonella infection
122904378
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
nvs04131
]
122904378
04121 Ubiquitin system [BR:
nvs04121
]
122904378
03036 Chromosome and associated proteins [BR:
nvs03036
]
122904378
Membrane trafficking [BR:
nvs04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
122904378
Ubiquitin system [BR:
nvs04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
122904378
Cul7 complex
122904378
Chromosome and associated proteins [BR:
nvs03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
122904378
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
122904378
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
122904378
NCBI-ProteinID:
XP_044101102
LinkDB
All DBs
Position
4:complement(34129530..34130222)
Genome browser
AA seq
163 aa
AA seq
DB search
MPSIKLQSSDGEIFEVDVEIAKQSVTVKTMLEDLGVDDEGDDDPVPLPNVNAAILKKIIQ
WCTHDKDDPPPPEDDENKEKWTDDIPVWDQEFLKVDQGTLLELILAANYLDIKGLLDVTR
KTVASMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWYEEK
NT seq
492 nt
NT seq
+upstream
nt +downstream
nt
atgccttcaattaagttgcagagttccgatggagagatatttgaagttgacgttgaaatc
gccaaacagtctgtgactgtcaagaccatgttggaagatttgggagtggacgatgaagga
gatgatgatccagttcctctaccaaatgttaatgcagcaatattaaaaaagatcattcaa
tggtgcacccatgacaaggatgacccccctcctcctgaggatgatgagaacaaagaaaag
tggacagatgatatccctgtttgggaccaagaattcctgaaagttgaccaaggaacactg
ttggaacttattctggctgcgaactacttagacatcaaaggtttgcttgatgttacacgc
aagactgttgccagtatgatcaaggggaaaactcctgaggagatccgcaagaccttcaat
atcaaaaatgactttactgaagaagaggaagcccaggtacgcaaagagaaccagtggtat
gaagagaagtga
DBGET
integrated database retrieval system