Neogale vison (American mink): 122905217 Help Entry 122905217         CDS       T08764                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism nvs  Neogale vison (American mink) Pathway nvs04072   Phospholipase D signaling pathway nvs04140   Autophagy - animal nvs04150   mTOR signaling pathway nvs04151   PI3K-Akt signaling pathway nvs04152   AMPK signaling pathway nvs04211   Longevity regulating pathway nvs04218   Cellular senescence nvs04714   Thermogenesis nvs04910   Insulin signaling pathway nvs04919   Thyroid hormone signaling pathway nvs05163   Human cytomegalovirus infection nvs05165   Human papillomavirus infection nvs05168   Herpes simplex virus 1 infection nvs05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     122905217 (RHEB)    04151 PI3K-Akt signaling pathway     122905217 (RHEB)    04152 AMPK signaling pathway     122905217 (RHEB)    04150 mTOR signaling pathway     122905217 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122905217 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     122905217 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     122905217 (RHEB)    04919 Thyroid hormone signaling pathway     122905217 (RHEB)   09149 Aging    04211 Longevity regulating pathway     122905217 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     122905217 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     122905217 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     122905217 (RHEB)    05163 Human cytomegalovirus infection     122905217 (RHEB)    05165 Human papillomavirus infection     122905217 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:nvs04031]     122905217 (RHEB) GTP-binding proteins [BR:nvs04031]  Small (monomeric) G-proteins   Ras Family    Rheb     122905217 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  122905217 NCBI-ProteinID:  XP_044102812 LinkDB All DBs Position 4:complement(225915909..225959446) Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacgattcagtttgttgaaggccagtttgttgactcctacgacccaaccatagaa aacactttcacaaaattgattacagtcaatggacaagaatatcatcttcaactggttgac acagctgggcaggatgaatactccatttttcctcagacgtactccatagatattaatggc tatattcttgtgtattctgtgacatcaatcaaaagttttgaagtgattaaagttattcat ggcaaattgttggatatggtggggaaagtgcaaatacctattatgttggttgggaataag aaagacctccatatggaaagggtgatcagttatgaagaagggaaggcgttagcagagtct tggaacgcagcttttttggaatcttctgctaaagaaaaccagacggccgttgacgttttt agaaggataattttggaggcagagaaaattgatggggccgcttcacaaggaaagtcgtcc tgctcggtgatgtaa

DBGET integrated database retrieval system