Neogale vison (American mink): 122906670 Help Entry 122906670         CDS       T08764                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism nvs  Neogale vison (American mink) Pathway nvs04015   Rap1 signaling pathway nvs04810   Regulation of actin cytoskeleton nvs05014   Amyotrophic lateral sclerosis nvs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     122906670 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     122906670 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122906670 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     122906670 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nvs04131]     122906670 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:nvs04812]     122906670 (PFN1)    04147 Exosome [BR:nvs04147]     122906670 (PFN1) Membrane trafficking [BR:nvs04131]  Others   Actin-binding proteins    Others     122906670 (PFN1) Cytoskeleton proteins [BR:nvs04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      122906670 (PFN1) Exosome [BR:nvs04147]  Exosomal proteins   Proteins found in most exosomes    122906670 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  122906670 NCBI-ProteinID:  XP_044104837 LinkDB All DBs Position 5:55800516..55803096 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtttgggccgccgtccccgggaagaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccgatcaagttttttc gtgaacgggctgacacttgggggccagaaatgttctgttatccgggactcactgctgcag gatggggagtttaccatggaccttcgtaccaagagcaccggtggagcccccactttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system