Neogale vison (American mink): 122906999 Help Entry 122906999         CDS       T08764                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism nvs  Neogale vison (American mink) Pathway nvs03410   Base excision repair nvs04140   Autophagy - animal nvs04217   Necroptosis nvs04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:nvs00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     122906999 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122906999 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     122906999 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122906999 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nvs03036]     122906999 (HMGB1)    03400 DNA repair and recombination proteins [BR:nvs03400]     122906999 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nvs04147]     122906999 (HMGB1) Chromosome and associated proteins [BR:nvs03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     122906999 (HMGB1) DNA repair and recombination proteins [BR:nvs03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      122906999 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      122906999 (HMGB1) Exosome [BR:nvs04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    122906999 (HMGB1) SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  122906999 NCBI-ProteinID:  XP_044105471 LinkDB All DBs Position 5:complement(94450315..94459594) Genome browser AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattctttgtg caaacttgccgggaggaacacaagaagaagcacccagatgcttcagtcaacttctcagag ttttctaagaagtgctcagaaaggtggaagaccatgtctgctaaagagaaaggaaaattt gaagacatggcaaaggctgacaaggcccgttatgaaagagaaatgaaaacttatattccc cctaaaggggaaacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg gcctttttcttgttttgttctgagtatcgcccaaaaatcaaaggagaacatccaggccta tccattggtgatgttgcaaagaaactgggagaaatgtggaataacactgctgcagatgac aagcagccttatgaaaagaaggctgctaagctgaaggaaaaatatgaaaaggatattgct gcataccgagctaaaggaaagcctgatgctgcaaaaaagggagtcgtcaaggctgaaaag agcaagaaaaagaaggaagaggaggaggatgaggaagatgaagaggatgaggaggaggag gaagatgaagaagatgaagatgaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system