Neogale vison (American mink): 122907685 Help Entry 122907685         CDS       T08764                                  Name (RefSeq) regakine-1-like   KO K05408   C-C motif chemokine 3 Organism nvs  Neogale vison (American mink) Pathway nvs04060   Cytokine-cytokine receptor interaction nvs04061   Viral protein interaction with cytokine and cytokine receptor nvs04062   Chemokine signaling pathway nvs04620   Toll-like receptor signaling pathway nvs05142   Chagas disease nvs05163   Human cytomegalovirus infection nvs05323   Rheumatoid arthritis nvs05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122907685    04061 Viral protein interaction with cytokine and cytokine receptor     122907685  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122907685    04062 Chemokine signaling pathway     122907685  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     122907685   09174 Infectious disease: parasitic    05142 Chagas disease     122907685   09163 Immune disease    05323 Rheumatoid arthritis     122907685   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122907685  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nvs04052]     122907685    00536 Glycosaminoglycan binding proteins [BR:nvs00536]     122907685 Cytokines and neuropeptides [BR:nvs04052]  Cytokines   Chemokines    122907685 Glycosaminoglycan binding proteins [BR:nvs00536]  Heparan sulfate / Heparin   Chemokines    122907685 SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  122907685 NCBI-ProteinID:  XP_044106432 LinkDB All DBs Position 5:complement(33680665..33686477) Genome browser AA seq 107 aa AA seqDB search MKVILATLTFFLILAALHSEANEEPVNKLTIIKCCFTYVSRKIPLRFVESYNRTSNQCST PGVIFLTRKGRQVCADPNVAWVQEHMRHLDHKSQRSESRGPHVAEEA NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcatcctggctaccctgaccttcttcctcattcttgctgccctccactctgag gccaatgaagaaccagtgaataaattaaccatcattaagtgctgtttcacctatgtctca cggaaaatcccactccggtttgtggaaagttataatagaaccagcaaccagtgctccacc ccaggggtcatcttccttacccgaaaaggccgacaggtctgcgcagaccccaatgttgcc tgggtgcaggagcacatgagacacctagaccacaagtctcagagatccgagagcagaggg ccccacgtggctgaggaagcttga

DBGET integrated database retrieval system