Neogale vison (American mink): 122908906 Help Entry 122908906         CDS       T08764                                  Symbol MRAS Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism nvs  Neogale vison (American mink) Pathway nvs04010   MAPK signaling pathway nvs04014   Ras signaling pathway nvs04015   Rap1 signaling pathway nvs04072   Phospholipase D signaling pathway nvs04137   Mitophagy - animal nvs04140   Autophagy - animal nvs04218   Cellular senescence nvs04371   Apelin signaling pathway nvs04625   C-type lectin receptor signaling pathway nvs04810   Regulation of actin cytoskeleton nvs05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122908906 (MRAS)    04014 Ras signaling pathway     122908906 (MRAS)    04015 Rap1 signaling pathway     122908906 (MRAS)    04371 Apelin signaling pathway     122908906 (MRAS)    04072 Phospholipase D signaling pathway     122908906 (MRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122908906 (MRAS)    04137 Mitophagy - animal     122908906 (MRAS)   09143 Cell growth and death    04218 Cellular senescence     122908906 (MRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122908906 (MRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122908906 (MRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     122908906 (MRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:nvs04031]     122908906 (MRAS) GTP-binding proteins [BR:nvs04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122908906 (MRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  122908906 NCBI-ProteinID:  XP_044108216 LinkDB All DBs Position 6:complement(125729165..125793523) Genome browser AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRATGTHKLQCVIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcaaccagtgccgtccccagtgacaacctccccacgtacaagctggtggtggtggga gatgggggtgtgggcaagagtgccctcaccatccagtttttccagaagatctttgtgcct gactacgaccccaccattgaagactcctacctgaaacacacagagattgacaatcagtgg gccatcctggatgttctggacacagctgggcaggaggagttcagcgccatgcgggagcag tatatgcgcacgggggatggcttcctcatcgtcttctcagtcaccgacaaggccagcttc gagcacgtggaccgcttccaccaacttatcctgcgcgtcaaggacagagagtcctttccg atgatcctcgtggccaacaaggtcgatctgatgcatttgaggaagatcaccagggagcaa ggaaaagaaatggcgaccaaacacaatattccatacatagaaaccagtgccaaggaccca cctctcaacgtggacaaagccttccatgacctggtcagggtaattaggcaacagattccg gaaaagagtcagaagaagaagaagaaaaccaaatggcggggagaccgggccactggcacc cacaaactgcagtgtgtgatattgtga

DBGET integrated database retrieval system