Neogale vison (American mink): 122909015 Help Entry 122909015         CDS       T08764                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism nvs  Neogale vison (American mink) Pathway nvs04014   Ras signaling pathway nvs04137   Mitophagy - animal nvs04144   Endocytosis nvs04145   Phagosome nvs04148   Efferocytosis nvs04962   Vasopressin-regulated water reabsorption nvs05014   Amyotrophic lateral sclerosis nvs05022   Pathways of neurodegeneration - multiple diseases nvs05132   Salmonella infection nvs05146   Amoebiasis nvs05152   Tuberculosis Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     122909015 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122909015 (RAB5A)    04145 Phagosome     122909015 (RAB5A)    04137 Mitophagy - animal     122909015 (RAB5A)    04148 Efferocytosis     122909015 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     122909015 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122909015 (RAB5A)    05152 Tuberculosis     122909015 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     122909015 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     122909015 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     122909015 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nvs04131]     122909015 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nvs04147]     122909015 (RAB5A)    04031 GTP-binding proteins [BR:nvs04031]     122909015 (RAB5A) Membrane trafficking [BR:nvs04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     122909015 (RAB5A)  Endosome - Lysosome transport     122909015 (RAB5A) Exosome [BR:nvs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122909015 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    122909015 (RAB5A)   Exosomal proteins of colorectal cancer cells    122909015 (RAB5A)   Exosomal proteins of bladder cancer cells    122909015 (RAB5A) GTP-binding proteins [BR:nvs04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     122909015 (RAB5A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 BrnT_toxin Motif Other DBs NCBI-GeneID:  122909015 NCBI-ProteinID:  XP_044108469 UniProt:  U6CRH0 LinkDB All DBs Position 6:143607806..143637285 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttgggaaatcaagcctagtgcttcgtttt gtgaagggccagtttcatgaatttcaagagagtaccataggggctgcttttctaacccaa actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaacgaggagtcctttgccagagccaaaaactgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggctgaccttgcaaataaa agagctgtcgatttccaggaagcacagtcctatgcagatgacaacagtttattattcatg gagacatcagccaaaacatcgatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaattctgcaagaggaagaggagtagac cttactgaacccacgcagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system