Neogale vison (American mink): 122909214 Help Entry 122909214         CDS       T08764                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism nvs  Neogale vison (American mink) Pathway nvs04810   Regulation of actin cytoskeleton nvs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nvs00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     122909214 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122909214 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  122909214 NCBI-ProteinID:  XP_044108952 LinkDB All DBs Position 6:complement(172613739..172623934) Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcaagaggatccggtgcagcgggagattcaccaggactgggcgaaccgagaa tacattgaggtcatcaccagcagcatcaagaagatcgcggactttctcaactcattcgat atgtcttgtcgttcaagacttgcaacactaaacgagaaattgacagccctcgaacggaga atagagtacattgaagcgcgggtgacaaaaggtgagaccctcacctag

DBGET integrated database retrieval system