Neogale vison (American mink): 122909429 Help Entry 122909429         CDS       T08764                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism nvs  Neogale vison (American mink) Pathway nvs04014   Ras signaling pathway nvs04015   Rap1 signaling pathway nvs04022   cGMP-PKG signaling pathway nvs04024   cAMP signaling pathway nvs04062   Chemokine signaling pathway nvs04071   Sphingolipid signaling pathway nvs04072   Phospholipase D signaling pathway nvs04081   Hormone signaling nvs04144   Endocytosis nvs04150   mTOR signaling pathway nvs04270   Vascular smooth muscle contraction nvs04310   Wnt signaling pathway nvs04350   TGF-beta signaling pathway nvs04360   Axon guidance nvs04510   Focal adhesion nvs04520   Adherens junction nvs04530   Tight junction nvs04611   Platelet activation nvs04621   NOD-like receptor signaling pathway nvs04625   C-type lectin receptor signaling pathway nvs04660   T cell receptor signaling pathway nvs04670   Leukocyte transendothelial migration nvs04722   Neurotrophin signaling pathway nvs04810   Regulation of actin cytoskeleton nvs04921   Oxytocin signaling pathway nvs04928   Parathyroid hormone synthesis, secretion and action nvs04972   Pancreatic secretion nvs05100   Bacterial invasion of epithelial cells nvs05132   Salmonella infection nvs05133   Pertussis nvs05135   Yersinia infection nvs05152   Tuberculosis nvs05163   Human cytomegalovirus infection nvs05200   Pathways in cancer nvs05203   Viral carcinogenesis nvs05205   Proteoglycans in cancer nvs05206   MicroRNAs in cancer nvs05210   Colorectal cancer nvs05417   Lipid and atherosclerosis nvs05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     122909429 (RHOA)    04015 Rap1 signaling pathway     122909429 (RHOA)    04310 Wnt signaling pathway     122909429 (RHOA)    04350 TGF-beta signaling pathway     122909429 (RHOA)    04072 Phospholipase D signaling pathway     122909429 (RHOA)    04071 Sphingolipid signaling pathway     122909429 (RHOA)    04024 cAMP signaling pathway     122909429 (RHOA)    04022 cGMP-PKG signaling pathway     122909429 (RHOA)    04150 mTOR signaling pathway     122909429 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     122909429 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122909429 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     122909429 (RHOA)    04520 Adherens junction     122909429 (RHOA)    04530 Tight junction     122909429 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122909429 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     122909429 (RHOA)    04621 NOD-like receptor signaling pathway     122909429 (RHOA)    04625 C-type lectin receptor signaling pathway     122909429 (RHOA)    04660 T cell receptor signaling pathway     122909429 (RHOA)    04670 Leukocyte transendothelial migration     122909429 (RHOA)    04062 Chemokine signaling pathway     122909429 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     122909429 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     122909429 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     122909429 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     122909429 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     122909429 (RHOA)   09158 Development and regeneration    04360 Axon guidance     122909429 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122909429 (RHOA)    05206 MicroRNAs in cancer     122909429 (RHOA)    05205 Proteoglycans in cancer     122909429 (RHOA)    05203 Viral carcinogenesis     122909429 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     122909429 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     122909429 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     122909429 (RHOA)    05135 Yersinia infection     122909429 (RHOA)    05133 Pertussis     122909429 (RHOA)    05152 Tuberculosis     122909429 (RHOA)    05100 Bacterial invasion of epithelial cells     122909429 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122909429 (RHOA)    05418 Fluid shear stress and atherosclerosis     122909429 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nvs04131]     122909429 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nvs04147]     122909429 (RHOA)    04031 GTP-binding proteins [BR:nvs04031]     122909429 (RHOA) Membrane trafficking [BR:nvs04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     122909429 (RHOA) Exosome [BR:nvs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122909429 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    122909429 (RHOA)   Exosomal proteins of colorectal cancer cells    122909429 (RHOA)   Exosomal proteins of bladder cancer cells    122909429 (RHOA) GTP-binding proteins [BR:nvs04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     122909429 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  122909429 NCBI-ProteinID:  XP_044109505 LinkDB All DBs Position 6:205663035..205722238 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgt ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatatcgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgaccgcttgaggcctctctcctatccggacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaatatcccagaaaaatggacc ccggaagtcaagcacttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcggaatgatgagcacacaaggcgggaactagccaagatgaagcaggagccggtgaaa cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system