Neogale vison (American mink): 122914045 Help Entry 122914045         CDS       T08764                                  Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism nvs  Neogale vison (American mink) Pathway nvs04613   Neutrophil extracellular trap formation nvs05034   Alcoholism nvs05203   Viral carcinogenesis nvs05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:nvs00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122914045  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     122914045   09163 Immune disease    05322 Systemic lupus erythematosus     122914045   09165 Substance dependence    05034 Alcoholism     122914045  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nvs03036]     122914045   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nvs04147]     122914045 Chromosome and associated proteins [BR:nvs03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122914045 Exosome [BR:nvs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122914045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  122914045 NCBI-ProteinID:  XP_044116624 LinkDB All DBs Position 1:147449462..147451145 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaacccgccaagtccgctccggccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaaacgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcccgc ctggcacactacaacaagcgctcgaccatcacgtccagggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system