Neogale vison (American mink): 122916174 Help Entry 122916174         CDS       T08764                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism nvs  Neogale vison (American mink) Pathway nvs01521   EGFR tyrosine kinase inhibitor resistance nvs01524   Platinum drug resistance nvs04014   Ras signaling pathway nvs04064   NF-kappa B signaling pathway nvs04115   p53 signaling pathway nvs04137   Mitophagy - animal nvs04140   Autophagy - animal nvs04151   PI3K-Akt signaling pathway nvs04210   Apoptosis nvs04215   Apoptosis - multiple species nvs04621   NOD-like receptor signaling pathway nvs04630   JAK-STAT signaling pathway nvs05012   Parkinson disease nvs05014   Amyotrophic lateral sclerosis nvs05022   Pathways of neurodegeneration - multiple diseases nvs05145   Toxoplasmosis nvs05162   Measles nvs05166   Human T-cell leukemia virus 1 infection nvs05168   Herpes simplex virus 1 infection nvs05170   Human immunodeficiency virus 1 infection nvs05200   Pathways in cancer nvs05202   Transcriptional misregulation in cancer nvs05212   Pancreatic cancer nvs05220   Chronic myeloid leukemia nvs05222   Small cell lung cancer nvs05225   Hepatocellular carcinoma nvs05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     122916174 (BCL2L1)    04630 JAK-STAT signaling pathway     122916174 (BCL2L1)    04064 NF-kappa B signaling pathway     122916174 (BCL2L1)    04151 PI3K-Akt signaling pathway     122916174 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122916174 (BCL2L1)    04137 Mitophagy - animal     122916174 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     122916174 (BCL2L1)    04215 Apoptosis - multiple species     122916174 (BCL2L1)    04115 p53 signaling pathway     122916174 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     122916174 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122916174 (BCL2L1)    05202 Transcriptional misregulation in cancer     122916174 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     122916174 (BCL2L1)    05225 Hepatocellular carcinoma     122916174 (BCL2L1)    05220 Chronic myeloid leukemia     122916174 (BCL2L1)    05222 Small cell lung cancer     122916174 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122916174 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     122916174 (BCL2L1)    05162 Measles     122916174 (BCL2L1)    05168 Herpes simplex virus 1 infection     122916174 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     122916174 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     122916174 (BCL2L1)    05014 Amyotrophic lateral sclerosis     122916174 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     122916174 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122916174 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     122916174 (BCL2L1)    01524 Platinum drug resistance     122916174 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:nvs01009]     122916174 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nvs03036]     122916174 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:nvs02000]     122916174 (BCL2L1) Protein phosphatases and associated proteins [BR:nvs01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      122916174 (BCL2L1) Chromosome and associated proteins [BR:nvs03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     122916174 (BCL2L1) Transporters [BR:nvs02000]  Other transporters   Pores ion channels [TC:1]    122916174 (BCL2L1) SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Nitrate_red_del Motif Other DBs NCBI-GeneID:  122916174 NCBI-ProteinID:  XP_044119212 UniProt:  A0A8C7BS96 LinkDB All DBs Position 8:26369825..26420612 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDAEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQALVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgcagaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtaaagcaagcgctaagggaggctggggatgagtttgaactgagg taccggcgggcattcagtgacctgacatctcagcttcacatcacccccgggacagcgtat cagagctttgagcaggtggtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggctctgtgcgtggagagcgtagacaaggagatgcag gcattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system