Neogale vison (American mink): 122916540 Help Entry 122916540         CDS       T08764                                  Symbol RAB1A Name (RefSeq) ras-related protein Rab-1A   KO K07874   Ras-related protein Rab-1A Organism nvs  Neogale vison (American mink) Pathway nvs04140   Autophagy - animal nvs05014   Amyotrophic lateral sclerosis nvs05022   Pathways of neurodegeneration - multiple diseases nvs05134   Legionellosis Brite KEGG Orthology (KO) [BR:nvs00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122916540 (RAB1A)  09160 Human Diseases   09171 Infectious disease: bacterial    05134 Legionellosis     122916540 (RAB1A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     122916540 (RAB1A)    05022 Pathways of neurodegeneration - multiple diseases     122916540 (RAB1A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nvs04131]     122916540 (RAB1A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nvs04147]     122916540 (RAB1A)    04031 GTP-binding proteins [BR:nvs04031]     122916540 (RAB1A) Membrane trafficking [BR:nvs04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     122916540 (RAB1A)  Autophagy   Other autophagy associated proteins     122916540 (RAB1A) Exosome [BR:nvs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122916540 (RAB1A)   Exosomal proteins of other body fluids (saliva and urine)    122916540 (RAB1A)   Exosomal proteins of colorectal cancer cells    122916540 (RAB1A) GTP-binding proteins [BR:nvs04031]  Small (monomeric) G-proteins   Rab Family    Rab1/35 [OT]     122916540 (RAB1A) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA SRPRB FeoB_N AAA ABC_tran AAA_7 AAA_29 LANC_like AAA_16 AAA_22 Septin AAA_5 Dioxygenase_N CRAL_TRIO_2 TniB Motif Other DBs NCBI-GeneID:  122916540 NCBI-ProteinID:  XP_044120037 UniProt:  A0A8C7ADH4 LinkDB All DBs Position 8:complement(86909829..86940979) Genome browser AA seq 205 aa AA seqDB search MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA TAGGAEKSNVKIQSTPVKQSGGGCC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggcgactct ggggttggaaagtcttgcctccttcttaggtttgcagatgatacatatacagaaagctat atcagcacaattggtgtggatttcaaaataagaactatagagttagatgggaaaacaatc aagcttcaaatatgggacacagcaggccaagaaagatttcgaacaatcacctccagttat tacagaggagcccatggcatcatagttgtgtatgatgtgacagatcaggagtccttcaat aatgttaaacagtggctgcaggaaatagaccgttacgccagtgaaaacgtcaacaagttg ttggtagggaacaaatgtgatctgaccacaaagaaagtagtagactacacaacagcaaag gaatttgctgattcccttggaattccatttttggaaaccagtgctaagaacgcaacgaat gtagaacagtctttcatgacgatggcagctgagattaaaaagcgaatgggtcctggagca acagctggtggtgcagagaagtccaatgtgaaaattcagagcactccagtcaagcagtca ggtggaggttgctgctaa

DBGET integrated database retrieval system