Neogale vison (American mink): 122916930 Help Entry 122916930         CDS       T08764                                  Name (RefSeq) interferon alpha-3-like   KO K05414   interferon alpha Organism nvs  Neogale vison (American mink) Pathway nvs04060   Cytokine-cytokine receptor interaction nvs04151   PI3K-Akt signaling pathway nvs04217   Necroptosis nvs04620   Toll-like receptor signaling pathway nvs04621   NOD-like receptor signaling pathway nvs04622   RIG-I-like receptor signaling pathway nvs04623   Cytosolic DNA-sensing pathway nvs04630   JAK-STAT signaling pathway nvs04650   Natural killer cell mediated cytotoxicity nvs04936   Alcoholic liver disease nvs05152   Tuberculosis nvs05160   Hepatitis C nvs05161   Hepatitis B nvs05162   Measles nvs05163   Human cytomegalovirus infection nvs05164   Influenza A nvs05165   Human papillomavirus infection nvs05167   Kaposi sarcoma-associated herpesvirus infection nvs05168   Herpes simplex virus 1 infection nvs05169   Epstein-Barr virus infection nvs05170   Human immunodeficiency virus 1 infection nvs05171   Coronavirus disease - COVID-19 nvs05200   Pathways in cancer nvs05320   Autoimmune thyroid disease nvs05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122916930    04151 PI3K-Akt signaling pathway     122916930   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122916930  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122916930  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122916930    04621 NOD-like receptor signaling pathway     122916930    04622 RIG-I-like receptor signaling pathway     122916930    04623 Cytosolic DNA-sensing pathway     122916930    04650 Natural killer cell mediated cytotoxicity     122916930  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122916930   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122916930    05161 Hepatitis B     122916930    05160 Hepatitis C     122916930    05171 Coronavirus disease - COVID-19     122916930    05164 Influenza A     122916930    05162 Measles     122916930    05168 Herpes simplex virus 1 infection     122916930    05163 Human cytomegalovirus infection     122916930    05167 Kaposi sarcoma-associated herpesvirus infection     122916930    05169 Epstein-Barr virus infection     122916930    05165 Human papillomavirus infection     122916930   09171 Infectious disease: bacterial    05152 Tuberculosis     122916930   09163 Immune disease    05320 Autoimmune thyroid disease     122916930   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122916930   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122916930  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nvs04052]     122916930 Cytokines and neuropeptides [BR:nvs04052]  Cytokines   Interferons    122916930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  122916930 NCBI-ProteinID:  XP_044120251 LinkDB All DBs Position 9:complement(47719249..47719746) Genome browser AA seq 165 aa AA seqDB search MALPCSSLVALVVLSCHSLGSLGCDLPRDHSVLNWRALMLLRQMKRISLISCDKYINDFA FTKKVFHSKQLQKAQALSVIYVMKQKIFHLFCTEASPAPWNTTLLEELCSGIYQQVNDLQ ACLMQEAGVEEMALVNGDSILRNYFQKISLYLQEKQYSLCAWEMV NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atggccctgccctgctcctccttggtggccctggtggtgctcagctgccactccctcggc tctctgggatgtgacctgcctcgggaccacagcgtgctgaactggagggccctgatgctc ctgagacaaatgaagagaatctcccttatctcttgtgacaagtacataaatgactttgcc tttaccaagaaggtatttcacagcaagcagctgcagaaggctcaagccctctctgtcatc tatgtgatgaagcagaagatcttccacctcttctgcacagaggcctcacctgctccttgg aacacgaccctcctggaggaattgtgctcaggaatttatcagcaggtgaatgacctacaa gcctgtctcatgcaggaggcaggggtggaagagatggccctggtgaatggggactccatc ctgaggaactacttccagaaaatctccctctatctacaagagaagcaatacagcctttgt gcctgggagatggtatga

DBGET integrated database retrieval system