Neisseria wadsworthii: H3L96_01050 Help Entry H3L96_01050       CDS       T07067                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nwd  Neisseria wadsworthii Pathway nwd01100   Metabolic pathways nwd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nwd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H3L96_01050 (acpP)    00074 Mycolic acid biosynthesis     H3L96_01050 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H3L96_01050 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QMT35885 LinkDB All DBs Position 199508..199744 Genome browser AA seq 78 aa AA seqDB search MSNIEQQVKKIVAEQLGVSEDEVKNESSFQDDLGADSLDTVELVMALEEAFGCEIPDEEA EKITTVQLAIDYINAHNG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcaaacatcgaacaacaagttaaaaaaattgttgctgaacaactgggcgtaagcgaa gacgaagtgaaaaacgaatcttcattccaagacgacttgggcgcagattctttggacact gtagagctggttatggctttggaagaagctttcggctgcgaaattcctgatgaggaagca gaaaaaatcactaccgtgcaactggcgattgattacattaacgcccacaacggctaa

DBGET integrated database retrieval system