Neisseria wadsworthii: H3L96_04790 Help Entry H3L96_04790       CDS       T07067                                  Name (GenBank) phenol hydroxylase subunit P4   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism nwd  Neisseria wadsworthii Pathway nwd00361   Chlorocyclohexane and chlorobenzene degradation nwd00362   Benzoate degradation nwd00623   Toluene degradation nwd01100   Metabolic pathways nwd01120   Microbial metabolism in diverse environments nwd01220   Degradation of aromatic compounds Module nwd_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:nwd00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     H3L96_04790    00361 Chlorocyclohexane and chlorobenzene degradation     H3L96_04790    00623 Toluene degradation     H3L96_04790 Enzymes [BR:nwd01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      H3L96_04790     1.14.13.244  phenol 2-monooxygenase (NADH)      H3L96_04790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  QMT36535 LinkDB All DBs Position complement(1032407..1032769) Genome browser AA seq 120 aa AA seqDB search MPTKAIHENYHGDIRDRRENFGGNILVYVGWDEHLLFCSAKAFPLPPAMTFKDFREHVLP EGFAQHPDFEHIKWNEVQWRLNNQAFSPDDGKTLEQLGFDHKSLLRFKTPGLNGWNGTGV NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgccaactaaagccatccatgaaaactaccacggcgacatccgtgaccgccgcgaaaac ttcggcggcaacatcttagtgtatgtcggatgggacgaacacctgctcttctgctccgcc aaagcgtttccgcttccgccggccatgaccttcaaagacttccgcgagcatgtgctgccc gaaggctttgcccaacaccccgacttcgaacacatcaagtggaacgaagtgcaatggcgg ctcaacaaccaagccttctcccccgacgacggcaaaacgctggagcagctcggtttcgac cacaaatcgctgctgcgcttcaaaacgcccgggctgaacggctggaacggcaccggcgtg tag

DBGET integrated database retrieval system