Neisseria wadsworthii: H3L96_11190 Help Entry H3L96_11190       CDS       T07067                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nwd  Neisseria wadsworthii Pathway nwd01100   Metabolic pathways nwd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nwd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H3L96_11190    00074 Mycolic acid biosynthesis     H3L96_11190   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H3L96_11190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 FitA-like_RHH Motif Other DBs NCBI-ProteinID:  QMT36878 LinkDB All DBs Position complement(2354558..2354803) Genome browser AA seq 81 aa AA seqDB search MTEQEIRRILTDALVNLFEIEPERIKPETNLYEDLEIDSIDAIDLIDHIKRETGRKLKAE DFRNVRTVDDVVQAVSKIEAE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaccgaacaagaaatccgccggattctgaccgatgctttagtgaatctgtttgaaatc gaacccgagcgcatcaagcccgaaaccaatctttacgaagatttggaaatcgacagcatc gacgccatcgacttaatcgaccacattaaacgcgaaaccggccgcaaactcaaagccgaa gacttccgcaacgtgcgcaccgtagatgatgtggtgcaggccgtatcaaagattgaggcc gaataa

DBGET integrated database retrieval system