Nematolebias whitei (Rio pearlfish): 119407840 Help Entry 119407840         CDS       T08042                                  Symbol ccl44 Name (RefSeq) chemokine (C-C motif) ligand 44   KO K21083   C-C motif chemokine 17 Organism nwh  Nematolebias whitei (Rio pearlfish) Pathway nwh04060   Cytokine-cytokine receptor interaction nwh04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:nwh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119407840 (ccl44)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     119407840 (ccl44)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nwh04052]     119407840 (ccl44) Cytokines and neuropeptides [BR:nwh04052]  Cytokines   Chemokines    119407840 (ccl44) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  119407840 NCBI-ProteinID:  XP_037530594 LinkDB All DBs Position 3:22267040..22271059 Genome browser AA seq 123 aa AA seqDB search MFILQMLTVLCLTAVFLASVEAKGVQMQRDVQCCMLYSQGKVRTKDVLRFEVQTEGPDCS IQAIILYTKKAVKCADPRDRKVKRLVRKLQQRQIKAMMWLFPRDNLPVMSEDKKDNWAVL NVQ NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgttcatcctgcagatgttgactgttctctgtctcactgctgtcttcctggcatctgtg gaagctaaaggcgtgcagatgcagagggatgtccagtgctgcatgttgtactcccagggc aaggtgcgtaccaaggatgtgctgcggtttgaggtgcagaccgaggggcctgactgcagt atacaagccatcattctttacacaaagaaggcagtgaagtgcgcagaccccagagatcgg aaggtgaagaggttggtgaggaagctccagcagagacaaatcaaggcgatgatgtggctc tttcctcgtgataacctgcccgtcatgtcagaggacaaaaaagacaactgggcggttctc aatgtgcagtga

DBGET integrated database retrieval system