Nematolebias whitei (Rio pearlfish): 119409113 Help Entry 119409113         CDS       T08042                                  Symbol insb Name (RefSeq) preproinsulin b   KO K04526   insulin Organism nwh  Nematolebias whitei (Rio pearlfish) Pathway nwh04010   MAPK signaling pathway nwh04068   FoxO signaling pathway nwh04081   Hormone signaling nwh04114   Oocyte meiosis nwh04140   Autophagy - animal nwh04150   mTOR signaling pathway nwh04810   Regulation of actin cytoskeleton nwh04910   Insulin signaling pathway nwh04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:nwh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119409113 (insb)    04068 FoxO signaling pathway     119409113 (insb)    04150 mTOR signaling pathway     119409113 (insb)   09133 Signaling molecules and interaction    04081 Hormone signaling     119409113 (insb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     119409113 (insb)   09143 Cell growth and death    04114 Oocyte meiosis     119409113 (insb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     119409113 (insb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     119409113 (insb)    04914 Progesterone-mediated oocyte maturation     119409113 (insb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nwh04052]     119409113 (insb) Cytokines and neuropeptides [BR:nwh04052]  Neuropeptides   Unclassified    119409113 (insb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  119409113 NCBI-ProteinID:  XP_037531907 LinkDB All DBs Position 4:complement(30940631..30944182) Genome browser AA seq 111 aa AA seqDB search MARVPWVVSALVLLVFCSPGASSAPSGHLCGYHLVDALYFVCGERGFFYNQNRIHKRDLE QLLGFLSKRVRQEVQQWRVLSGRDEPKVKRGIVEQCCHTPCSIHHLEGYCD NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagggtaccatgggtggtgtcggcactggtactgcttgtgttctgctctccaggg gcttcctcagcccccagcggacacctgtgtggttaccacctggtggatgccctctacttc gtatgtggagagagggggtttttctacaatcaaaaccgtatccacaaacgagatctggaa cagcttcttgggttcctgtctaaacgggtcagacaggaagtgcagcagtggagagttctg tcaggccgggatgaacccaaggtgaaaagaggcatcgtggagcagtgctgccataccccg tgcagcattcaccacctggagggctactgtgactga

DBGET integrated database retrieval system