Nematolebias whitei (Rio pearlfish): 119409364 Help Entry 119409364         CDS       T08042                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism nwh  Nematolebias whitei (Rio pearlfish) Pathway nwh04010   MAPK signaling pathway nwh04144   Endocytosis nwh04370   VEGF signaling pathway nwh04510   Focal adhesion nwh04520   Adherens junction nwh04530   Tight junction nwh04810   Regulation of actin cytoskeleton nwh04912   GnRH signaling pathway nwh05100   Bacterial invasion of epithelial cells nwh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nwh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119409364 (cdc42l)    04370 VEGF signaling pathway     119409364 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     119409364 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     119409364 (cdc42l)    04520 Adherens junction     119409364 (cdc42l)    04530 Tight junction     119409364 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     119409364 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     119409364 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119409364 (cdc42l)    05100 Bacterial invasion of epithelial cells     119409364 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nwh04131]     119409364 (cdc42l)    03036 Chromosome and associated proteins [BR:nwh03036]     119409364 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nwh04147]     119409364 (cdc42l)    04031 GTP-binding proteins [BR:nwh04031]     119409364 (cdc42l) Membrane trafficking [BR:nwh04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     119409364 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     119409364 (cdc42l)   Macropinocytosis    Ras GTPases     119409364 (cdc42l) Chromosome and associated proteins [BR:nwh03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     119409364 (cdc42l) Exosome [BR:nwh04147]  Exosomal proteins   Exosomal proteins of microglial cells    119409364 (cdc42l)   Exosomal proteins of breast milk    119409364 (cdc42l) GTP-binding proteins [BR:nwh04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     119409364 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  119409364 NCBI-ProteinID:  XP_037532172 LinkDB All DBs Position 5:14780801..14791642 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPSTPFLLVGTQVDLR DDTNTVEKLAKNKQRPLYPESGEKLARELRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKSKKKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacgataaaatgtgtcgtggtaggagatggtgcagttggaaagacctgcttactg atctcctacacaaccaacaagtttccttcagaatatgtgccaacagtgtttgacaattat gcagtgacagtgatgattggaggagagccttatacgctcggtctctttgacacagcaggt caggaagattatgacaggctgcgtcctctcagctacccacaaacggacgtcttcctcgtg tgtttctctgtcgtttccccctcgtcgtttgaaaatgtcaaagagaagtgggtacctgag atttcccaccattgtccaagcacacctttcctattggtgggcacacaagtagacctgcgg gacgacaccaacactgtggagaagctggcgaagaacaaacagcgtcccctttaccccgag agtggcgagaagttggcgcgtgagctcagagctgtcaaatacgtggagtgctccgcgctc acacagcgaggacttaagaatgtatttgacgaggccatactggcagcgttggaacctcct gagaccaaatctaagaagaagtgtgttctgctataa

DBGET integrated database retrieval system