Nematolebias whitei (Rio pearlfish): 119409968 Help Entry 119409968         CDS       T08042                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism nwh  Nematolebias whitei (Rio pearlfish) Pathway nwh04068   FoxO signaling pathway nwh04136   Autophagy - other nwh04140   Autophagy - animal nwh04621   NOD-like receptor signaling pathway nwh04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:nwh00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     119409968 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     119409968 (atg12)    04136 Autophagy - other     119409968 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     119409968 (atg12)    04622 RIG-I-like receptor signaling pathway     119409968 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nwh04131]     119409968 (atg12)    04121 Ubiquitin system [BR:nwh04121]     119409968 (atg12)    03029 Mitochondrial biogenesis [BR:nwh03029]     119409968 (atg12) Membrane trafficking [BR:nwh04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     119409968 (atg12) Ubiquitin system [BR:nwh04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    119409968 (atg12) Mitochondrial biogenesis [BR:nwh03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     119409968 (atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  119409968 NCBI-ProteinID:  XP_037532800 LinkDB All DBs Position 5:15641765..15646178 Genome browser AA seq 117 aa AA seqDB search MSDTAESPTEPQKEEPQQPTDSSATNEDKKKIDVLLKAVGDTPIMKTRKWAIDRGRTVQS LAQFISRFLKFDANEQLFIYVNQSFSPSPDQEVGVLFDCFGSDGKLVLHYCKSQAWG NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtctgacactgccgagtccccaacggaaccacaaaaagaagagccacaacaaccgaca gattcttccgcaactaatgaagacaagaaaaaaattgatgtgctgttgaaggcggtggga gacactcctataatgaaaacaaggaagtgggcgattgacaggggcaggacggtgcagtcc ctagcacagttcatatctcgctttctcaagtttgatgctaacgaacaactgttcatctat gttaatcagtctttttctccttcacccgatcaagaagtaggagtcctctttgattgtttc ggcagcgatggcaaactagttctgcattactgtaaatctcaagcctggggttaa

DBGET integrated database retrieval system