Nematolebias whitei (Rio pearlfish): 119411319 Help Entry 119411319         CDS       T08042                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism nwh  Nematolebias whitei (Rio pearlfish) Pathway nwh04517   IgSF CAM signaling nwh04814   Motor proteins nwh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nwh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     119411319 (dynll2a)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     119411319 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119411319 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:nwh03037]     119411319 (dynll2a)    04812 Cytoskeleton proteins [BR:nwh04812]     119411319 (dynll2a) Cilium and associated proteins [BR:nwh03037]  Motile cilia and associated proteins   Dynein arm    119411319 (dynll2a) Cytoskeleton proteins [BR:nwh04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      119411319 (dynll2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  119411319 NCBI-ProteinID:  XP_037534186 LinkDB All DBs Position 6:38050323..38053603 Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSDDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaccgacaggaaggcagtgatcaagaacgcggacatgtccgacgacatgcagcaggac gccgtggactgtgccacccaggccatggagaagtacaacatagagaaggacatcgctgcc tacatcaagaaggagtttgacaagaagtataatcccacctggcactgcatcgttgggagg aacttcggcagctacgtcacccacgagacgaagcattttatttatttttatctgggccaa gtggccatcttactcttcaagtctggctga

DBGET integrated database retrieval system