Nematolebias whitei (Rio pearlfish): 119411715 Help Entry 119411715         CDS       T08042                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism nwh  Nematolebias whitei (Rio pearlfish) Pathway nwh04137   Mitophagy - animal nwh04140   Autophagy - animal nwh04144   Endocytosis nwh04145   Phagosome nwh04148   Efferocytosis nwh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nwh00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     119411715 (rab7a)    04145 Phagosome     119411715 (rab7a)    04140 Autophagy - animal     119411715 (rab7a)    04137 Mitophagy - animal     119411715 (rab7a)    04148 Efferocytosis     119411715 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119411715 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nwh04131]     119411715 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nwh04147]     119411715 (rab7a)    04031 GTP-binding proteins [BR:nwh04031]     119411715 (rab7a) Membrane trafficking [BR:nwh04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     119411715 (rab7a) Exosome [BR:nwh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119411715 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    119411715 (rab7a)   Exosomal proteins of colorectal cancer cells    119411715 (rab7a)   Exosomal proteins of bladder cancer cells    119411715 (rab7a) GTP-binding proteins [BR:nwh04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     119411715 (rab7a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 PduV-EutP Septin NTPase_1 AAA_7 AAA_16 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NB-ARC NACHT AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  119411715 NCBI-ProteinID:  XP_037534559 LinkDB All DBs Position 7:12093927..12102113 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRSQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagtacttctcaaagtcatcatccttggagactctggcgttgga aagacctcattaatgaaccagtatgtgaataagaagttcagcaaccagtacaaagcaaca attggagctgatttcctgacgaaagaagttatggtagatgacaggctcgtcacaatgcag atctgggacacagcaggtcaagagaggttccagtccttaggcgtcgctttctaccgtgga gcagactgctgtgttctggtcttcgatgtcaccgcacccaacaccttcaagaccttagac agctggagggacgagttcttgatccaggcgagcccccgagatccagagaatttccccttc gtggtgctgggcaacaagatcgacttggagaacagacaggtgacaaccaaacgatcacag gcttggtgtcagagcaagaacaacatcccatattttgaaaccagcgctaaggaggcgatc aacgtggagcaggccttccagactattgcacgcaatgctcttaaacaggagactgaagtg gagttgtacaacgagttccctgagccaataaagctggacaggaacgagcgagccaagccg tctgcagaaacctgcagctgctga

DBGET integrated database retrieval system