Nematolebias whitei (Rio pearlfish): 119418235 Help Entry 119418235         CDS       T08042                                  Symbol dynlt1b Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism nwh  Nematolebias whitei (Rio pearlfish) Pathway nwh04145   Phagocytosis nwh04814   Motor proteins nwh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nwh00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     119418235 (dynlt1b)   09142 Cell motility    04814 Motor proteins     119418235 (dynlt1b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119418235 (dynlt1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:nwh03037]     119418235 (dynlt1b)    04812 Cytoskeleton proteins [BR:nwh04812]     119418235 (dynlt1b) Cilium and associated proteins [BR:nwh03037]  Motile cilia and associated proteins   Dynein arm    119418235 (dynlt1b) Cytoskeleton proteins [BR:nwh04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      119418235 (dynlt1b) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 DUF5650 Motif Other DBs NCBI-GeneID:  119418235 NCBI-ProteinID:  XP_037541422 LinkDB All DBs Position 12:35951955..35953281 Genome browser AA seq 114 aa AA seqDB search MDDYLAEEEQTTFVVEEVSRIIKDSVETTIGGNAYQHNRVNQWTNSVVEHCLSQLSKLGK PFKYIVTCIIMQKNGAGLQTASTCFWDNTTDATCAVTWQNKSMYCIVNVFGLAI NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggacgactatctggcagaagaggagcagaccacgtttgtcgtcgaagaagtgagcaga atcataaaagattcagtagaaacaaccataggaggaaatgcttaccaacacaacagagtg aatcaatggacaaacagtgtagtggagcactgcctcagtcaactcagcaaactggggaaa cccttcaaatacattgttacttgcatcattatgcagaaaaatggagcaggactgcagaca gccagtacatgcttctgggacaacactactgatgctacctgtgcagtgacatggcagaac aagtccatgtactgcatcgtcaacgtgtttggtttggccatctga

DBGET integrated database retrieval system